Active Recombinant Human SLAMF7, Fc-tagged, Biotinylated
| Cat.No. : | SLAMF7-688H |
| Product Overview : | The recombinant human SLAMF7-Fc fusion protein is expressed as a 432-amino acid protein consisting of Ser23 - Met2250 region of SLAMF7 (UniProt accession #Q9NQ25) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 23-2250 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Immobilized SLAMF7 interacts homophilically with SLAMF7 in a functional ELISA |
| Molecular Mass : | Calculated molecular mass (kDa): 48.0; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 |
| AA Sequence : | SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKK NDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAA NESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | SLAMF7 SLAM family member 7 [ Homo sapiens ] |
| Official Symbol | SLAMF7 |
| Synonyms | SLAMF7; SLAM family member 7; 19A; CD319; CRACC; CS1; protein 19A; CD2 subset 1; 19A24 protein; membrane protein FOAP-12; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; novel LY9 (lymphocyte antigen 9) like protein; |
| Gene ID | 57823 |
| mRNA Refseq | NM_021181 |
| Protein Refseq | NP_067004 |
| MIM | 606625 |
| UniProt ID | Q9NQ25 |
| Chromosome Location | 1q23.1-q24.1 |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| SLAMF7-2018H | Recombinant Human SLAMF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLAMF7-21H | Recombinant Human SLAMF7 protein, MYC/DDK-tagged | +Inquiry |
| SLAMF7-186HA | Recombinant Human SLAMF7 protein, Fc-tagged, APC labeled | +Inquiry |
| SLAMF7-448H | Recombinant Full Length Human SLAMF7 Protein, His-tagged | +Inquiry |
| SLAMF7-3355H | Active Recombinant Human SLAMF7 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
| SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *
