Active Recombinant Human SLAMF9, Fc-tagged
Cat.No. : | SLAMF9-692H |
Product Overview : | The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 - Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 19-234 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
Bio-activity : | Immobilized SLAMF9 interacts homophilically with SLAMF9 in a functional ELISA and inhibits anti--CD3e antibody induced IL-2 secretion by human T cells |
Molecular Mass : | Calculated molecular mass (kDa): 49.6; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
AA Sequence : | RRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEGHPATIMVTNPHYQGQVSFLDPS YSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITVNFESSGEGACSMSLVCSVEKAGMDMT YSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAFGSTGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | SLAMF9 SLAM family member 9 [ Homo sapiens ] |
Official Symbol | SLAMF9 |
Synonyms | CD2F10; CD84H1; SF2001; CD2F-10; CD84-H1 |
Gene ID | 89886 |
mRNA Refseq | NM_033438.3 |
Protein Refseq | NP_254273.2 |
MIM | 608589 |
UniProt ID | Q96A28 |
Chromosome Location | 1q23.2 |
Function | receptor activity; |
◆ Recombinant Proteins | ||
SLAMF9-920C | Recombinant Cynomolgus SLAMF9 Protein, His-tagged | +Inquiry |
Slamf9-6809M | Recombinant Mouse Slamf9 Protein (Phe18-Leu230), C-His tagged | +Inquiry |
SLAMF9-663C | Recombinant Cynomolgus Monkey SLAMF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLAMF9-2869H | Recombinant Human SLAMF9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SLAMF9-15197M | Recombinant Mouse SLAMF9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF9-1808HCL | Recombinant Human SLAMF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLAMF9 Products
Required fields are marked with *
My Review for All SLAMF9 Products
Required fields are marked with *