Active Recombinant Human SLAMF9, Fc-tagged, Biotinylated

Cat.No. : SLAMF9-691H
Product Overview : The recombinant human SLAMF9-Fc fusion protein is expressed as a 445-amino acid protein consisting of Arg19 - Phe234 region of SLAMF9 (UniProt accession #Q96A28) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 19-234 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized SLAMF9 interacts homophilically with SLAMF9 in a functional ELISA and inhibits anti--CD3e antibody induced IL-2 secretion by human T cells
Molecular Mass : Calculated molecular mass (kDa): 49.6; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
AA Sequence : RRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKSLATVVPGKEGHPATIMVTNPHYQGQVSFLDPS YSLHISNLSWEDSGLYQAQVNLRTSQISTMQQYNLCVYRWLSEPQITVNFESSGEGACSMSLVCSVEKAGMDMT YSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAFGSTGTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG K
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name SLAMF9 SLAM family member 9 [ Homo sapiens ]
Official Symbol SLAMF9
Synonyms CD2F10; CD84H1; SF2001; CD2F-10; CD84-H1
Gene ID 89886
mRNA Refseq NM_033438.3
Protein Refseq NP_254273.2
MIM 608589
UniProt ID Q96A28
Chromosome Location 1q23.2
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLAMF9 Products

Required fields are marked with *

My Review for All SLAMF9 Products

Required fields are marked with *

0
cart-icon
0
compare icon