Active Recombinant Human SNCA Protein
Cat.No. : | SNCA-01H |
Product Overview : | Active Full Length Human Recombinant Alpha Synuclein Pre-formed Fibrils (Type 1) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. |
Bio-activity : | Endogenous alpha-synuclein phosphorylation. 100 μM alpha synuclein protein monomer seeded with 10 μM alpha synuclein protein PFF in 25 μM Thioflavin T (PBS pH 7.4, 100 μL reaction volume) generated a fluorescence intensity of 13,000 Relative Fluorescence Units after incubation at 37 centigrade with shaking at 600 rpm. Fluorescence was measured by excitation at 450 nm and emission at 485 nm on a Molecular Devices Gemini XPS microplate reader. |
AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
Purity : | >95% |
Applications : | WB, SDS-PAGE, In vivo assay, In vitro assay |
Storage : | Store at -80 centigrade. |
Storage Buffer : | PBS |
Shipping : | Dry Ice. |
Full Length : | Full L. |
Gene Name | SNCA synuclein alpha [ Homo sapiens (human) ] |
Official Symbol | SNCA |
Synonyms | SNCA; synuclein alpha; PD1; NACP; PARK1; PARK4; alpha-synuclein;I+/--synuclein;non A-beta component of AD amyloid;synuclein alpha-140;synuclein, alpha (non A4 component of amyloid precursor);truncated alpha synuclein |
Gene ID | 6622 |
mRNA Refseq | NM_000345 |
Protein Refseq | NP_000336 |
MIM | 163890 |
UniProt ID | P37840 |
◆ Recombinant Proteins | ||
SNCA-293H | Recombinant Human Synuclein, Alpha (Non A4 Component of Amyloid Precursor), 1-60 | +Inquiry |
SNCA-2837H | Recombinant Human SNCA, GST-tagged | +Inquiry |
Snca-1372R | Recombinant Rat Snca Protein, GST-tagged | +Inquiry |
SNCA-60H | Recombinant Human SNCA Protein | +Inquiry |
SNCA-240H | Active Recombinant Human SNCA protein | +Inquiry |
◆ Native Proteins | ||
SNCA-27345TH | Native Human SNCA | +Inquiry |
SNCA-27342TH | Native Human SNCA | +Inquiry |
SNCA-27341TH | Native Human SNCA | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCA-1634HCL | Recombinant Human SNCA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNCA Products
Required fields are marked with *
My Review for All SNCA Products
Required fields are marked with *
0
Inquiry Basket