Active Recombinant Human SPARC Protein, Tag Free
| Cat.No. : | SPARC-31437TH |
| Product Overview : | Recombinant Human SPARC ; 286 amino acids, Predicted MWt 33 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | CHO |
| Tag : | Non |
| Protein Length : | 18-303 a.a. |
| Description : | Secreted protein acidic and rich in cysteine/osteonectin/BM40, or SPARC, is a matrix-associated protein that elicits changes in cell shape, inhibits cell-cycle progression, and influences the synthesis of extracellular matrix (ECM) (Bradshaw et al. |
| Molecular Weight : | 33.000kDa |
| Biological activity : | Determined by its ability to increase alkaline phosphatase activity in differentiating MC3T3 cells using a concentration of 0.5-0.7 μg/ml. |
| Form : | Lyophilised:Reconstitute in waterto a concentration of 0.1-1.0 mg/ml |
| Purity : | by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10mM Sodium phosphate, pH 7.6 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI |
| Sequence Similarities : | Belongs to the SPARC family.Contains 1 EF-hand domain.Contains 1 follistatin-like domain.Contains 1 Kazal-like domain. |
| Gene Name | SPARC secreted protein, acidic, cysteine-rich (osteonectin) [ Homo sapiens ] |
| Official Symbol | SPARC |
| Synonyms | SPARC; secreted protein, acidic, cysteine-rich (osteonectin); ON; cysteine rich protein; osteonectin; |
| Gene ID | 6678 |
| mRNA Refseq | NM_003118 |
| Protein Refseq | NP_003109 |
| MIM | 182120 |
| Uniprot ID | P09486 |
| Chromosome Location | 5q31-q33 |
| Pathway | Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Response to elevated platelet cytosolic Ca2+, organism-specific biosystem; Senescence and Autophagy, organism-specific biosystem; |
| Function | calcium ion binding; collagen binding; extracellular matrix binding; protein binding; |
| ◆ Recombinant Proteins | ||
| SPARC-4111H | Recombinant Human SPARC Protein, His (Fc)-Avi-tagged | +Inquiry |
| SPARC-30654TH | Recombinant Human SPARC, MBP-tagged | +Inquiry |
| SPARC-2899H | Recombinant Human SPARC, GST-tagged | +Inquiry |
| SPARC-01H | Recombinant Human SPARC Protein, His-Tagged | +Inquiry |
| SPARC-6343H | Recombinant Human SPARC Protein (Ala18-Ile303), N-His tagged | +Inquiry |
| ◆ Native Proteins | ||
| SPARC-30653TH | Native Human SPARC | +Inquiry |
| SPARC-287B | Native Bovine Osteonectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPARC-2120MCL | Recombinant Mouse SPARC cell lysate | +Inquiry |
| SPARC-2616HCL | Recombinant Human SPARC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPARC Products
Required fields are marked with *
My Review for All SPARC Products
Required fields are marked with *




