Active Recombinant Human ST6GAL1 Protein, His&GFP tagged
| Cat.No. : | ST6GAL1-11H |
| Product Overview : | Recombinant Human CMP-N-acetylneuraminate beta-galactosamide-alpha-2,6 sialyltransferase (ST6GAL1) with N-terminal 6×His, GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Protein Length : | 75-406 aa |
| Description : | This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants. |
| Form : | Supplied as a 0.2 μm filtered solution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol and 0.05 % NaN3 as preservative. |
| Bio-activity : | Specific Activity is ≥0.5 μmol/min/mg. Measured by the ability to transfer the sugar from CMP-Neu5Ac and generate CMP 100mM MES, pH 6.5 |
| Molecular Mass : | ~60-70kDa |
| AASequence : | RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC |
| Purity : | >95%, by SDS_PAGE under reducing conditions and visualized by Coomassie Blue stain. |
| Storage : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 μg/μL |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 [ Homo sapiens ] |
| Official Symbol | ST6GAL1 |
| Synonyms | ST6GAL1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; sialyltransferase 1 (beta galactoside alpha 2,6 sialytransferase) , SIAT1; beta-galactoside alpha-2,6-sialyltransferase 1; ST6Gal I; alpha 2,6-ST 1; B-cell antigen CD75; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6N; SIAT1; ST6GalI; MGC48859; |
| Gene ID | 6480 |
| mRNA Refseq | NM_173216 |
| Protein Refseq | NP_775323 |
| MIM | 109675 |
| UniProt ID | P15907 |
| ◆ Recombinant Proteins | ||
| ST6GAL1-6794C | Recombinant Chicken ST6GAL1 | +Inquiry |
| ST6GAL1-5097H | Recombinant Human ST6GAL1 Protein (Lys27-Cys406), N-His tagged | +Inquiry |
| ST6GAL1-14H | Active Recombinant Human ST6GAL1 Protein (AA 75-406), N-6×His/GFP tagged | +Inquiry |
| ST6GAL1-28H | Active Recombinant Human ST6GAL1 Protein | +Inquiry |
| ST6GAL1-4501R | Recombinant Rhesus monkey ST6GAL1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST6GAL1-1919HCL | Recombinant Human ST6GAL1 cell lysate | +Inquiry |
| ST6GAL1-1760MCL | Recombinant Mouse ST6GAL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST6GAL1 Products
Required fields are marked with *
My Review for All ST6GAL1 Products
Required fields are marked with *
