Active Recombinant Human ST6GAL1 Protein (75-406), N-6×His and GFP tagged
| Cat.No. : | ST6GAL1-11H |
| Product Overview : | Recombinant Human CMP-N-acetylneuraminate beta-galactosamide-alpha-2,6-sialyltransferase (ST6GAL1) with a N-6×His, GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | 75-406 |
| Description : | This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants. |
| Bio-activity : | ≥0.5 μmol/min/mg |
| Molecular Mass : | ~60-70 kDa |
| AA Sequence : | RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC |
| Purity : | >95%, by SDS_PAGE under reducing conditions and visualized by Coomassie Blue stain |
| Storage : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Storage Buffer : | Supplied as a 0.2 μm filtered soulution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol and 0.05 % NaN3 as preservative. |
| Shipping : | This product is shipped as 0.2 μm filtered product on dry ice. Upon receipt, store it immediately at the temperature recommended below. |
| Gene Name | ST6GAL1 ST6 beta-galactoside alpha-2,6-sialyltransferase 1 [ Homo sapiens (human) ] |
| Official Symbol | ST6GAL1 |
| Synonyms | ST6GAL1; ST6 beta-galactoside alpha-2,6-sialyltransferase 1; ST6N; CDw75; SIAT1; ST6GalI; beta-galactoside alpha-2,6-sialyltransferase 1; B-cell antigen CD75; CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; alpha 2,6-ST 1; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); EC 2.4.3.1 |
| Gene ID | 6480 |
| mRNA Refseq | NM_173216 |
| Protein Refseq | NP_775323 |
| MIM | 109675 |
| UniProt ID | P15907 |
| ◆ Recombinant Proteins | ||
| ST6GAL1-2739H | Recombinant Human ST6GAL1 Protein, His-tagged | +Inquiry |
| ST6GAL1-6794C | Recombinant Chicken ST6GAL1 | +Inquiry |
| RFL34414HF | Recombinant Full Length Human Beta-Galactoside Alpha-2,6-Sialyltransferase 1(St6Gal1) Protein, His-Tagged | +Inquiry |
| ST6GAL1-4147H | Recombinant Human ST6GAL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ST6GAL1-58H | Recombinant Human ST6GAL1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST6GAL1-1760MCL | Recombinant Mouse ST6GAL1 cell lysate | +Inquiry |
| ST6GAL1-1919HCL | Recombinant Human ST6GAL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST6GAL1 Products
Required fields are marked with *
My Review for All ST6GAL1 Products
Required fields are marked with *
