Active Recombinant Human ST6GAL1 Protein (75-406), N-6×His and GFP tagged

Cat.No. : ST6GAL1-11H
Product Overview : Recombinant Human CMP-N-acetylneuraminate beta-galactosamide-alpha-2,6-sialyltransferase (ST6GAL1) with a N-6×His, GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : 75-406
Description : This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
Bio-activity : ≥0.5 μmol/min/mg
Molecular Mass : ~60-70 kDa
AA Sequence : RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
Purity : >95%, by SDS_PAGE under reducing conditions and visualized by Coomassie Blue stain
Storage : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Storage Buffer : Supplied as a 0.2 μm filtered soulution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol and 0.05 % NaN3 as preservative.
Shipping : This product is shipped as 0.2 μm filtered product on dry ice. Upon receipt, store it immediately at the temperature recommended below.
Gene Name ST6GAL1 ST6 beta-galactoside alpha-2,6-sialyltransferase 1 [ Homo sapiens (human) ]
Official Symbol ST6GAL1
Synonyms ST6GAL1; ST6 beta-galactoside alpha-2,6-sialyltransferase 1; ST6N; CDw75; SIAT1; ST6GalI; beta-galactoside alpha-2,6-sialyltransferase 1; B-cell antigen CD75; CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; alpha 2,6-ST 1; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); EC 2.4.3.1
Gene ID 6480
mRNA Refseq NM_173216
Protein Refseq NP_775323
MIM 109675
UniProt ID P15907

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ST6GAL1 Products

Required fields are marked with *

My Review for All ST6GAL1 Products

Required fields are marked with *

0
cart-icon