Active Recombinant Human ST6GAL1 Protein, His&GFP tagged

• Cat.No.: ST6GAL1-11H
• Product Overview: Recombinant Human CMP-N-acetylneuraminate beta-galactosamide-alpha-2,6 sialyltransferase (ST6GAL1) with N-terminal 6×His, GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Protein Length: 75-406 aa
• Description: This gene encodes a member of glycosyltransferase family 29. The encoded protein is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The protein, which is normally found in the Golgi but can be proteolytically processed to a soluble form, is involved in the generation of the cell-surface carbohydrate determinants and differentiation antigens HB-6, CD75, and CD76. This gene has been incorrectly referred to as CD75. Alternative splicing results in multiple transcript variants.
• Form: Supplied as a 0.2 μm filtered solution in 20mM HEPES and 100mM NaCl buffer, pH 7.0, with 10% Glycerol and 0.05 % NaN3 as preservative.
• Bio-activity: Specific Activity is ≥0.5 μmol/min/mg. Measured by the ability to transfer the sugar from CMP-Neu5Ac and generate CMP 100mM MES, pH 6.5
• Molecular Mass: ~60-70kDa
• AASequence: RQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
• Purity: >95%, by SDS_PAGE under reducing conditions and visualized by Coomassie Blue stain.
• Storage: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 μg/μL
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 [ Homo sapiens ]
• Official Symbol: ST6GAL1
• Synonyms: ST6GAL1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; sialyltransferase 1 (beta galactoside alpha 2,6 sialytransferase) , SIAT1; beta-galactoside alpha-2,6-sialyltransferase 1; ST6Gal I; alpha 2,6-ST 1; B-cell antigen CD75; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6N; SIAT1; ST6GalI; MGC48859
• Gene ID: 6480
• mRNA Refseq: NM_173216
• Protein Refseq: NP_775323
• MIM: 109675
• UniProt ID: P15907