Active Recombinant Human ST6GALNAC2 Protein (AA 68-374), N-6×His/GFP tagged
| Cat.No. : | ST6GALNAC2-16H |
| Product Overview : | Recombinant Human ST6GALNAC2 Protein (AA 68-374) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 68-374 |
| Description : | ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]). |
| Bio-activity : | ≥0.084 μmol/min/mg |
| Molecular Mass : | ~65-70 kDa |
| AA Sequence : | SWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR |
| Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
| Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
| Preservative : | 0.05 % NaN3 |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | ST6GALNAC2 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 [ Homo sapiens (human) ] |
| Official Symbol | ST6GALNAC2 |
| Synonyms | ST6GALNAC2; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; sialyltransferase 7 ((alpha N acetylneuraminyl 2,3 beta galactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialyltransferase) , sialyltransferase like 1 , SIAT7, SIAT7B, SIATL1; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; ST6GalNAII; STHM; SIAT7-B; ST6GalNAcII; ST6GalNAc II; sialyltransferase 7B; sialyltransferase-like 1; galNAc alpha-2,6-sialyltransferase II; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) B; SIAT7; SAITL1; SIAT7B; SIATL1; FLJ45660; |
| Gene ID | 10610 |
| mRNA Refseq | NM_006456 |
| Protein Refseq | NP_006447 |
| MIM | 610137 |
| UniProt ID | Q9UJ37 |
| ◆ Recombinant Proteins | ||
| RFL6619MF | Recombinant Full Length Mouse Alpha-N-Acetylgalactosaminide Alpha-2,6-Sialyltransferase 2(St6Galnac2) Protein, His-Tagged | +Inquiry |
| ST6GALNAC2-5563H | Recombinant Human ST6GALNAC2 Protein (Ser29-Arg374), C-His tagged | +Inquiry |
| ST6GALNAC2-912M | Recombinant Mouse ST6GALNAC2 Protein, His-tagged | +Inquiry |
| ST6GALNAC2-195H | Recombinant Human ST6GALNAC2, His-tagged | +Inquiry |
| ST6GALNAC2-2979H | Recombinant Human ST6GALNAC2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ST6GALNAC2-1613MCL | Recombinant Mouse ST6GALNAC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ST6GALNAC2 Products
Required fields are marked with *
My Review for All ST6GALNAC2 Products
Required fields are marked with *
