Active Recombinant Human ST6GALNAC2 Protein (AA 68-374), N-6×His/GFP tagged

Cat.No. : ST6GALNAC2-16H
Product Overview : Recombinant Human ST6GALNAC2 Protein (AA 68-374) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 68-374
Description : ST6GALNAC2 belongs to a family of sialyltransferases that add sialic acids to the nonreducing ends of glycoconjugates. At the cell surface, these modifications have roles in cell-cell and cell-substrate interactions, bacterial adhesion, and protein targeting (Samyn-Petit et al., 2000 [PubMed 10742600]).
Bio-activity : ≥0.084 μmol/min/mg
Molecular Mass : ~65-70 kDa
AA Sequence : SWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR
Purity : >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name ST6GALNAC2 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 [ Homo sapiens (human) ]
Official Symbol ST6GALNAC2
Synonyms ST6GALNAC2; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; sialyltransferase 7 ((alpha N acetylneuraminyl 2,3 beta galactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialyltransferase) , sialyltransferase like 1 , SIAT7, SIAT7B, SIATL1; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2; ST6GalNAII; STHM; SIAT7-B; ST6GalNAcII; ST6GalNAc II; sialyltransferase 7B; sialyltransferase-like 1; galNAc alpha-2,6-sialyltransferase II; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide B; (alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase; sialyltransferase 7 ((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialyltransferase) B; SIAT7; SAITL1; SIAT7B; SIATL1; FLJ45660;
Gene ID 10610
mRNA Refseq NM_006456
Protein Refseq NP_006447
MIM 610137
UniProt ID Q9UJ37

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ST6GALNAC2 Products

Required fields are marked with *

My Review for All ST6GALNAC2 Products

Required fields are marked with *

0
cart-icon