Active Recombinant Human superoxide dismutase 2 Protein, His tagged

Cat.No. : SOD2-30343TH
Product Overview : Active recombinant human SOD2 protein was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 25-222 aa
Description : This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and converts them to hydrogen peroxide and diatomic oxygen. Mutations in this gene have been associated with idiopathic cardiomyopathy (IDC), premature aging, sporadic motor neuron disease, and cancer. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome 1.
Form : Liquid
Molecular Mass : 24.4 kDa (219aa) confirmed by MALDI-TOF
AA Sequence : < MGSSHHHHHHSSGLVPRGSHM> KHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
Bio-Activity : Specific activity is > 1,000 unit/mg, in which one unit will inhibit the rate of reduction of cytochrome c by 50 % in a coupled system, using xanthine and Xanthine oxidase at pH 7.5 at 25 centigrade.
Purity : > 95 % by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 20 % glycerol
Concentration : 0.5 mg/mL (determined by Bradford assay)
Reference : 1. MacMillan-Crow L.A., et al. (1999) Arch. Biochem. Biophys. 366:82-88
2. Prunotto M, et al. (2010) J Am Soc Nephrol. 21(3):507-19.
Gene Name SOD2 superoxide dismutase 2 [ Homo sapiens (human) ]
Official Symbol SOD2
Synonyms SOD2; superoxide dismutase 2, mitochondrial; superoxide dismutase [Mn], mitochondrial; indophenoloxidase B; Mn superoxide dismutase; mangano-superoxide dismutase; manganese-containing superoxide dismutase; IPOB; MNSOD; MVCD6
Gene ID 6648
mRNA Refseq NM_000636
Protein Refseq NP_001019636
MIM 147460
UniProt ID P04179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SOD2 Products

Required fields are marked with *

My Review for All SOD2 Products

Required fields are marked with *

0
cart-icon