Active Recombinant Human TFF3 protein, Tag Free

Cat.No. : TFF3-652H
Product Overview : Recombinant Human TFF3 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 22-80 a.a.
Description : Trefoil factor 3 encoded by the TFF3 gene in humans, belongs to the trefoil factor family that consists of three members named TFF1, TFF2 and TFF3. They are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. TFF-3 is expressed by goblet cells and in the uterus, and has also been shown to express in certain cancers, including colorectal, hepatocellular, and in biliary tumors. It involves in the maintenance and repair of the intestinal mucosa, also promotes the mobility of epithelial cells in healing processes. TFF3 overexpression is crucial for progression in mouse and human hepatocellular carcinogenesis. TFF3 may be useful as a molecular marker for certain types of cancer, but its role, if any, in tumorigenesis is unknown.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10 μg/ml, corresponding to a specific activity of > 100 IU/mg.
Molecular Mass : Approximately 13.2 kDa, a homodimeric protein consisting of two 59 amino acid chains, which includes a 40-amino acid trefoil motif containing three conserved intramolecular disulfide bonds.
AA Sequence : EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Endotoxin : Less than 1 EU/μg of rHuTFF3 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name TFF3
Official Symbol TFF3
Synonyms TFF3; trefoil factor 3 (intestinal); trefoil factor 3; HITF; ITF; polypeptide P1.B; P1B; TFI;
Gene ID 7033
mRNA Refseq NM_003226
Protein Refseq NP_003217
MIM 600633
UniProt ID Q07654

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFF3 Products

Required fields are marked with *

My Review for All TFF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon