Active Recombinant Human TFPI2, Animal Free
Cat.No. : | TFPI2-129H |
Product Overview : | Recombinant human TFPI-2 domain 1, is a 9.3 kDa protein containing 79 amino acids residues. Human recombinant protein expressed in Nicotiana benthamiana. Recombinant AGV212contains a 6-His-tag at the N-terminal end, is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. Animal free product. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | Non |
Description : | Recombinant human TFPI-2 domain 1 or AGV 212 is a protease inhibitor peptide generated from the first Kunitz domain of the human Tissue Factor Protein Inhibitor 2 (TFPI-2) protein, after site-directed mutagenesis to increase its activity. It is arranged in a single polypeptide chain that is linked by three disulphide bridges. AGV 212 is quite stable and inhibits trypsin with high efficiency and Ki lower than TFPI-2 one. TFPI-2 has been shown to inhibit Endothelial Cell Matrix (ECM) proteases essential for angiogenesis and metastasis. |
Form : | Lyophilized powder containing phosphate buffer salts, pH 7.1. |
Bio-activity : | The activity of the inhibitor is expressed as the amount of trypsin inhibited per milligram of inhibitor. The ability to prevent the hydrolysis of benzoyl-L-arginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. One mg protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein. |
Molecular Mass : | Recombinant human TFPI-2 domain 1, is a 9.3 kDa protein containing 79 amino acids residues. |
AA Sequence : | HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEK VPKV |
Endotoxin : | < 0.04="" eu="" ug="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Applications : | Trypsin inhibitor, Western blot, Immunogen |
Storage : | This lyophilized preparation is stable at 2-8°C, but should be kept at –20°C for long term storage. Diluted solutions are less stable than concentrated ones. Repeated freezing and thawing is not recommended. |
Reconstitution : | Lyophilized protein should be reconstituted adding 1 ml of sterile water to the vial, which gives a concentration of 1 mg of protease inhibitor per ml. At higher concentration the solubility may be reduced and multimers generated. Soluble in water and in aqueous buffers of low ionic strengths. Repeated freeze-thaw cycles should be avoided. Optimal reconstitution please follow batch Quality Control sheet instructions. |
Gene Name | TFPI2 tissue factor pathway inhibitor 2 [ Homo sapiens ] |
Official Symbol | TFPI2 |
Synonyms | TFPI2; tissue factor pathway inhibitor 2; PP5; REF1; TFPI 2; placental protein 5; TFPI-2; FLJ21164; |
Gene ID | 7980 |
mRNA Refseq | NM_006528 |
Protein Refseq | NP_006519 |
MIM | 600033 |
UniProt ID | P48307 |
Chromosome Location | 7q |
Function | extracellular matrix structural constituent; peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
TFPI2-5403H | Recombinant Human TFPI2 Protein (Asp23-Lys213), C-His tagged | +Inquiry |
Tfpi2-1997R | Recombinant Rat Tfpi2 protein, His-tagged | +Inquiry |
TFPI2-754H | Recombinant Human TFPI2 Protein | +Inquiry |
TFPI2-226H | Recombinant Human TFPI2 Protein, His-tagged | +Inquiry |
TFPI2-876H | Recombinant Human TFPI2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFPI2-1519MCL | Recombinant Mouse TFPI2 cell lysate | +Inquiry |
TFPI2-2771HCL | Recombinant Human TFPI2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TFPI2 Products
Required fields are marked with *
My Review for All TFPI2 Products
Required fields are marked with *
0
Inquiry Basket