Active Recombinant Human TGFBR2, Fc-tagged, Biotinylated
Cat.No. : | TGFBR2-697H |
Product Overview : | The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 - Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 23-159 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Immobilized TGFBR2 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60 |
AA Sequence : | TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENIT LETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ] |
Official Symbol | TGFBR2 |
Synonyms | TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII; |
Gene ID | 7048 |
mRNA Refseq | NM_001024847 |
Protein Refseq | NP_001020018 |
MIM | 190182 |
UniProt ID | P37173 |
Chromosome Location | 3p22 |
Pathway | ALK1 signaling events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem; |
Function | ATP binding; SMAD binding; glycosaminoglycan binding; metal ion binding; nucleotide binding; protein binding; contributes_to protein binding; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta binding; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; type I transforming growth factor beta receptor binding; type I transforming growth factor beta receptor binding; type III transforming growth factor beta receptor binding; |
◆ Recombinant Proteins | ||
TGFBR2-0797H | Active Recombinant Human TGFBR2 protein, Fc-Avi-tagged, Biotinylated | +Inquiry |
Tgfbr2-1778M | Recombinant Mouse Transforming Growth Factor, Beta Receptor II | +Inquiry |
TGFBR2-909HFL | Recombinant Full Length Human TGFBR2 Protein, C-Flag-tagged | +Inquiry |
Tgfbr2-3573R | Recombinant Rat Tgfbr2 protein, His&Myc-tagged | +Inquiry |
Tgfbr2-15M | Recombinant Mouse Tgfbr2(Ile24-Asp184) Protein, C-Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR2-1291CCL | Recombinant Cynomolgus TGFBR2 cell lysate | +Inquiry |
TGFBR2-1374RCL | Recombinant Rat TGFBR2 cell lysate | +Inquiry |
TGFBR2-2842HCL | Recombinant Human TGFBR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFBR2 Products
Required fields are marked with *
My Review for All TGFBR2 Products
Required fields are marked with *
0
Inquiry Basket