Active Recombinant Human TGFBR2, Fc-tagged, Biotinylated

Cat.No. : TGFBR2-697H
Product Overview : The recombinant human TGFBR2-Fc fusion protein is expressed as a 365 amino acid protein consisting of Thr23 - Asp159 region of TGFBR2 (UniProt accession #P37173) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 23-159 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized TGFBR2 protein binds human TGFβ1 in a functional ELISA. Blocks TGFβ1-mediated signaling activity.
Molecular Mass : Calculated molecular mass (kDa): 41.1; Estimated by SDS-PAGE under reducing condition (kDa): ~60
AA Sequence : TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENIT LETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDSSGTHTCPPCP APELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVS VLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Conjugation : Biotin
Gene Name TGFBR2 transforming growth factor, beta receptor II (70/80kDa) [ Homo sapiens ]
Official Symbol TGFBR2
Synonyms TGFBR2; transforming growth factor, beta receptor II (70/80kDa); MFS2, transforming growth factor, beta receptor II (70 80kD); TGF-beta receptor type-2; tbetaR-II; TGF-beta receptor type II; TGF-beta type II receptor; TGF-beta receptor type IIB; transforming growth factor-beta receptor type II; transforming growth factor beta receptor type IIC; transforming growth factor, beta receptor II (70/80kDa) isoform 1; transforming growth factor, beta receptor II (70/80kDa) isoform 2; AAT3; FAA3; MFS2; RIIC; LDS1B; LDS2B; TAAD2; TGFR-2; TGFbeta-RII;
Gene ID 7048
mRNA Refseq NM_001024847
Protein Refseq NP_001020018
MIM 190182
UniProt ID P37173
Chromosome Location 3p22
Pathway ALK1 signaling events, organism-specific biosystem; Adherens junction, organism-specific biosystem; Adherens junction, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Chronic myeloid leukemia, organism-specific biosystem; Chronic myeloid leukemia, conserved biosystem;
Function ATP binding; SMAD binding; glycosaminoglycan binding; metal ion binding; nucleotide binding; protein binding; contributes_to protein binding; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta binding; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transforming growth factor beta-activated receptor activity; transmembrane receptor protein serine/threonine kinase activity; type I transforming growth factor beta receptor binding; type I transforming growth factor beta receptor binding; type III transforming growth factor beta receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TGFBR2 Products

Required fields are marked with *

My Review for All TGFBR2 Products

Required fields are marked with *

0
cart-icon