Active Recombinant Human TIE1, Fc-tagged, Biotinylated
Cat.No. : | TIE1-700H |
Product Overview : | The recombinant human Tie1-Fc fusion is expressed as a 967 amino acid protein consisting of Ala22 - Gln759 region of Tie1 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-759 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Interacts with Tie2 and inhibits angiopoietin/Tie2-mediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 105.5; Estimated by SDS-PAGE under reducing condition (kDa): 110-120 |
AA Sequence : | LSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGA GRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGC SCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLE TMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRF KVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPK TGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWD GTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI QLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEE STLGNGLQAEGPVQESRAAEEGLDQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | TIE1 tyrosine kinase with immunoglobulin-like and EGF-like domains 1 [ Homo sapiens ] |
Official Symbol | TIE1 |
Synonyms | TIE1; tyrosine kinase with immunoglobulin-like and EGF-like domains 1; TIE, tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; tyrosine-protein kinase receptor Tie-1; JTK14; tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; TIE; |
Gene ID | 7075 |
mRNA Refseq | NM_001253357 |
Protein Refseq | NP_001240286 |
MIM | 600222 |
UniProt ID | P35590 |
Chromosome Location | 1p34-p33 |
Function | ATP binding; nucleotide binding; protein binding; protein tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; |
◆ Recombinant Proteins | ||
Tie1-88M | Recombinant Mouse Tie1, Fc-tagged | +Inquiry |
Tie1-7352M | Active Recombinant Mouse Tie1 Protein, His-tagged | +Inquiry |
TIE1-144H | Recombinant Human TIE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
TIE1-1256H | Recombinant Human TIE1 Protein, His-tagged | +Inquiry |
TIE1-16775M | Recombinant Mouse TIE1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIE1-2034HCL | Recombinant Human TIE1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TIE1 Products
Required fields are marked with *
My Review for All TIE1 Products
Required fields are marked with *
0
Inquiry Basket