Active Recombinant Human TNFRSF14 Protein, Fc-tagged

• Cat.No.: TNFRSF14-878H
• Product Overview: Recombinant Human TNFRSF14 fused with Fc tag at C-terminal was expressed in Hi-5 Insect cells.

Specification

• Species: Human
• Source: Hi-5 Insect Cells
• Tag: Fc
• Description: This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
• Bio-activity: Determined by its ability to neutralize 0.25 ng/ml of hTNFβ induced cytotoxicity on murine L929 cells. The expected ED50 for this effect is 1.3-1.9 ug/mL of HVEM-Fc.
• Molecular Mass: 41 kDa
• AA Sequence: LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer

Gene Information

• Gene Name: TNFRSF14 tumor necrosis factor receptor superfamily, member 14 [ Homo sapiens ]
• Official Symbol: TNFRSF14
• Synonyms: TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2
• Gene ID: 8764
• mRNA Refseq: NM_003820
• Protein Refseq: NP_003811
• MIM: 602746
• UniProt ID: Q92956