Active Recombinant Human TNFRSF14 Protein, Fc-tagged

Cat.No. : TNFRSF14-878H
Product Overview : Recombinant Human TNFRSF14 fused with Fc tag at C-terminal was expressed in Hi-5 Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Hi-5 Insect Cells
Tag : Fc
Description : This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Bio-activity : Determined by its ability to neutralize 0.25 ng/ml of hTNFβ induced cytotoxicity on murine L929 cells. The expected ED50 for this effect is 1.3-1.9 ug/mL of HVEM-Fc.
Molecular Mass : 41 kDa
AA Sequence : LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name TNFRSF14 tumor necrosis factor receptor superfamily, member 14 [ Homo sapiens ]
Official Symbol TNFRSF14
Synonyms TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2;
Gene ID 8764
mRNA Refseq NM_003820
Protein Refseq NP_003811
MIM 602746
UniProt ID Q92956

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF14 Products

Required fields are marked with *

My Review for All TNFRSF14 Products

Required fields are marked with *

0
cart-icon
0
compare icon