Active Recombinant Human TNFRSF25 Protein, hIgG/His-tagged

Cat.No. : TNFRSF25-10H
Product Overview : Recombinant human TNFRSF25 (25-199 aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 417
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human TL1A/TNFSF15. The ED50 range ≤ 5 μg/mL.
Molecular Mass : 46.1 kDa
AA Sequence : QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name TNFRSF25 TNF receptor superfamily member 25 [ Homo sapiens (human) ]
Official Symbol TNFRSF25
Synonyms TNFRSF25; TNF receptor superfamily member 25; DR3; TR3; DDR3; LARD; APO-3; TRAMP; WSL-1; GEF720; WSL-LR; PLEKHG5; TNFRSF12; tumor necrosis factor receptor superfamily member 25; Guanine nucleotide exchange factor 720; PH domain-containing family G member 5; Pleckstrin homology domain-containing family G member 5; apoptosis inducing receptor; apoptosis-inducing receptor AIR; apoptosis-mediating receptor DR3; apoptosis-mediating receptor TRAMP; death domain receptor 3 soluble form; death receptor beta; lymphocyte-associated receptor of death; protein WSL-1; tumor necrosis factor receptor superfamily, member 12 (translocating chain-association membrane protein)
Gene ID 8718
mRNA Refseq NM_003790
Protein Refseq NP_003781
MIM 603366
UniProt ID Q93038

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All T Products

Required fields are marked with *

My Review for All T Products

Required fields are marked with *

0
cart-icon
0
compare icon