Active Recombinant Human TNFRSF4, Fc-tagged, Biotinylated
| Cat.No. : | TNFRSF4-659H |
| Product Overview : | The recombinant human OX40-Fc fusion is expressed as a 414 amino acid protein consisting of Leu29 - Ala214 region of OX40 (UniProt accession #P43489) and a C-terminal Fc from human IgG1, which exists as a dimer/tetramer under non-reducing conditions |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 29-214 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds to OX40 ligand and anti-OX40/CD134 monoclonal antibodies with high affinity by ELISA. Blocks OX40 Ligand-induced signaling activity. |
| Molecular Mass : | Calculated molecular mass (kDa): 45.5; Estimated by SDS-PAGE under reducing condition (kDa): ~65 |
| AA Sequence : | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTAT QDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQP QETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
| Official Symbol | TNFRSF4 |
| Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor; |
| Gene ID | 7293 |
| mRNA Refseq | NM_003327 |
| Protein Refseq | NP_003318 |
| MIM | 600315 |
| UniProt ID | P43489 |
| Chromosome Location | 1p36 |
| Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; |
| Function | binding; receptor activity; tumor necrosis factor-activated receptor activity; |
| ◆ Recombinant Proteins | ||
| TNFRSF4-152H | Recombinant Human TNFRSF4 Protein, DYKDDDDK-tagged | +Inquiry |
| Tnfrsf4-547MAF555 | Recombinant Mouse Tnfrsf4 Protein, Alexa Fluor 555 conjugated | +Inquiry |
| TNFRSF4-3247HAF647 | Recombinant Human TNFRSF4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| RFL13373RF | Recombinant Full Length Rat Tumor Necrosis Factor Receptor Superfamily Member 4(Tnfrsf4) Protein, His-Tagged | +Inquiry |
| TNFRSF4-843M | Recombinant Mouse TNFRSF4 Protein (Met1-Pro211), RlgG Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
| TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
