Active Recombinant Human TNFRSF4 Protein, hIgG/His-tagged

• Cat.No.: TNFRSF4-05H
• Product Overview: Recombinant human TNFRSF4 (29-214aa), fused to hIgG-His-tag at C terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: Insect Cells
• Tag: Fc&His
• Protein Length: 29-214 a.a.
• Description: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.
• Form: Liquid
• Bio-activity: Measured by its binding ability in a functional ELISA with mouse OX40 Ligand/TNFSF4. The ED50 range ≤ 0.15 μg/mL.
• Molecular Mass: 46.9 KDa (425aa)
• AA Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Bioactivity
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.5 mg/mL (determined by absorbance at 280nm)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol

Gene Information

• Gene Name: TNFRSF4 TNF receptor superfamily member 4 [ Homo sapiens (human) ]
• Official Symbol: TNFRSF4
• Synonyms: TNFRSF4; TNF receptor superfamily member 4; OX40; ACT35; CD134; IMD16; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 antigen; OX40 cell surface antigen; OX40 homologue; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; lymphoid activation antigene ACT35; tax-transcriptionally activated glycoprotein 1 receptor
• Gene ID: 7293
• mRNA Refseq: NM_003327
• Protein Refseq: NP_003318
• MIM: 600315
• UniProt ID: P43489