Active Recombinant Human TNFRSF4 Protein, hIgG/His-tagged

Cat.No. : TNFRSF4-05H
Product Overview : Recombinant human TNFRSF4 (29-214aa), fused to hIgG-His-tag at C terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Fc&His
Protein Length : 29-214 a.a.
Description : The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with mouse OX40 Ligand/TNFSF4. The ED50 range ≤ 0.15 μg/mL.
Molecular Mass : 46.9 KDa (425aa)
AA Sequence : LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name TNFRSF4 TNF receptor superfamily member 4 [ Homo sapiens (human) ]
Official Symbol TNFRSF4
Synonyms TNFRSF4; TNF receptor superfamily member 4; OX40; ACT35; CD134; IMD16; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 antigen; OX40 cell surface antigen; OX40 homologue; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; lymphoid activation antigene ACT35; tax-transcriptionally activated glycoprotein 1 receptor
Gene ID 7293
mRNA Refseq NM_003327
Protein Refseq NP_003318
MIM 600315
UniProt ID P43489

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFRSF4 Products

Required fields are marked with *

My Review for All TNFRSF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon