Active Recombinant Human TNFRSF4 Protein, hIgG/His-tagged
Cat.No. : | TNFRSF4-05H |
Product Overview : | Recombinant human TNFRSF4 (29-214aa), fused to hIgG-His-tag at C terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Fc&His |
Protein Length : | 29-214 a.a. |
Description : | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with mouse OX40 Ligand/TNFSF4. The ED50 range ≤ 0.15 μg/mL. |
Molecular Mass : | 46.9 KDa (425aa) |
AA Sequence : | LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | TNFRSF4 TNF receptor superfamily member 4 [ Homo sapiens (human) ] |
Official Symbol | TNFRSF4 |
Synonyms | TNFRSF4; TNF receptor superfamily member 4; OX40; ACT35; CD134; IMD16; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 antigen; OX40 cell surface antigen; OX40 homologue; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; lymphoid activation antigene ACT35; tax-transcriptionally activated glycoprotein 1 receptor |
Gene ID | 7293 |
mRNA Refseq | NM_003327 |
Protein Refseq | NP_003318 |
MIM | 600315 |
UniProt ID | P43489 |
◆ Recombinant Proteins | ||
TNFRSF4-0593R | Recombinant Rat TNFRSF4 protein, Fc-tagged | +Inquiry |
TNFRSF4-341M | Active Recombinant Mouse TNFRSF4 Protein, His & Avi-tagged, Biotinylated | +Inquiry |
Tnfrsf4-547MF | Recombinant Mouse Tnfrsf4 Protein, FITC conjugated | +Inquiry |
TNFRSF4-3247HAF647 | Recombinant Human TNFRSF4 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Tnfrsf4-5752M | Recombinant Mouse Tnfrsf4 Protein (Val20-Pro211), C-Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
0
Inquiry Basket