Active Recombinant Human TNFSF4

Cat.No. : TNFSF4-27254TH
Product Overview : Recombinant Human TNFSF4 was expressed in Hi-5 Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Hi-5 Insect Cells
Tag : Non
Protein Length : 51-183 aa
Description : This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
Bio-activity : Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors.
Molecular Mass : 15 kDa
AA Sequence : QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEP LFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Gene Name TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ]
Official Symbol TNFSF4
Synonyms TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L
Gene ID 7292
mRNA Refseq NM_003326
Protein Refseq NP_003317
MIM 603594
UniProt ID P23510
Chromosome Location 1q25
Pathway Cytokine-cytokine receptor interaction; TSLP Signaling Pathway
Function cytokine activity; receptor binding; tumor necrosis factor receptor binding; tumor necrosis factor receptor superfamily binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF4 Products

Required fields are marked with *

My Review for All TNFSF4 Products

Required fields are marked with *

0
cart-icon
0
compare icon