Active Recombinant Human TNFSF4
Cat.No. : | TNFSF4-27254TH |
Product Overview : | Recombinant Human TNFSF4 was expressed in Hi-5 Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Hi-5 Insect Cells |
Tag : | Non |
Protein Length : | -5 a.a. |
Description : | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. |
Bio-activity : | Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors. |
Molecular Mass : | 15 kDa |
AA Sequence : | QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEP LFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Gene Name | TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ] |
Official Symbol | TNFSF4 |
Synonyms | TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L |
Gene ID | 7292 |
mRNA Refseq | NM_003326 |
Protein Refseq | NP_003317 |
MIM | 603594 |
UniProt ID | P23510 |
Chromosome Location | 1q25 |
Pathway | Cytokine-cytokine receptor interaction; TSLP Signaling Pathway |
Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; tumor necrosis factor receptor superfamily binding |
◆ Recombinant Proteins | ||
TNFSF4-5644H | Recombinant Human TNFSF4 protein, His-Flag-tagged | +Inquiry |
TNFSF4-0589H | Active Recombinant Human TNFSF4 protein, Fc-tagged | +Inquiry |
TNFSF4-85C | Active Recombinant Cynomolgus TNFSF4, Fc-tagged | +Inquiry |
TNFSF4-086H | Recombinant Human TNFSF4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
Tnfsf4-90M | Active Recombinant Mouse Tnfsf4 Protein (Gln49-Leu198), N-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF4-857CCL | Recombinant Cynomolgus TNFSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *
0
Inquiry Basket