Active Recombinant Human TNFSF4
| Cat.No. : | TNFSF4-27254TH |
| Product Overview : | Recombinant Human TNFSF4 was expressed in Hi-5 Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Hi-5 Insect Cells |
| Tag : | Non |
| Protein Length : | 51-183 aa |
| Description : | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. |
| Bio-activity : | Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors. |
| Molecular Mass : | 15 kDa |
| AA Sequence : | QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEP LFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration : | Resuspend the protein in the desired concentration in proper buffer |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Gene Name | TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ] |
| Official Symbol | TNFSF4 |
| Synonyms | TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L |
| Gene ID | 7292 |
| mRNA Refseq | NM_003326 |
| Protein Refseq | NP_003317 |
| MIM | 603594 |
| UniProt ID | P23510 |
| Chromosome Location | 1q25 |
| Pathway | Cytokine-cytokine receptor interaction; TSLP Signaling Pathway |
| Function | cytokine activity; receptor binding; tumor necrosis factor receptor binding; tumor necrosis factor receptor superfamily binding |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNFSF4 Products
Required fields are marked with *
My Review for All TNFSF4 Products
Required fields are marked with *
