Active Recombinant Human TNFSF4

• Cat.No.: TNFSF4-27254TH
• Product Overview: Recombinant Human TNFSF4 was expressed in Hi-5 Insect cells.

Specification

• Species: Human
• Source: Hi-5 Insect Cells
• Tag: Non
• Protein Length: -5 a.a.
• Description: This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
• Bio-activity: Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/ml. Note: Results may vary with PBMC donors.
• Molecular Mass: 15 kDa
• AA Sequence: QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEP LFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2

Gene Information

• Gene Name: TNFSF4 tumor necrosis factor (ligand) superfamily, member 4 [ Homo sapiens (human) ]
• Official Symbol: TNFSF4
• Synonyms: TNFSF4; tumor necrosis factor (ligand) superfamily, member 4; tax transcriptionally activated glycoprotein 1, 34kD , TXGP1; tumor necrosis factor ligand superfamily member 4; CD252; gp34; OX 40L
• Gene ID: 7292
• mRNA Refseq: NM_003326
• Protein Refseq: NP_003317
• MIM: 603594
• UniProt ID: P23510
• Chromosome Location: 1q25
• Pathway: Cytokine-cytokine receptor interaction; TSLP Signaling Pathway
• Function: cytokine activity; receptor binding; tumor necrosis factor receptor binding; tumor necrosis factor receptor superfamily binding