Active Recombinant Human TNFSF8 Protein, His-tagged

Cat.No. : TNFSF8-890H
Product Overview : Recombinant Human TNFSF8 fused with His tag at N-terminal was expressed in CHO cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : His
Description : Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Bio-activity : Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors.
Molecular Mass : 21 kDa
AA Sequence : HHHHHHHHPSPGGSGGQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ]
Official Symbol TNFSF8
Synonyms TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144;
Gene ID 944
mRNA Refseq NM_001244
Protein Refseq NP_001235
MIM 603875
UniProt ID P32971

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TNFSF8 Products

Required fields are marked with *

My Review for All TNFSF8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon