Active Recombinant Human TNFSF8 Protein, His-tagged
Cat.No. : | TNFSF8-890H |
Product Overview : | Recombinant Human TNFSF8 fused with His tag at N-terminal was expressed in CHO cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Tag : | His |
Description : | Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Bio-activity : | Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors. |
Molecular Mass : | 21 kDa |
AA Sequence : | HHHHHHHHPSPGGSGGQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | TNFSF8 tumor necrosis factor (ligand) superfamily, member 8 [ Homo sapiens ] |
Official Symbol | TNFSF8 |
Synonyms | TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; CD30LG; tumor necrosis factor ligand superfamily member 8; CD153; CD30-L; CD30 ligand; CD153 antigen; CD30 antigen ligand; CD30L; MGC138144; |
Gene ID | 944 |
mRNA Refseq | NM_001244 |
Protein Refseq | NP_001235 |
MIM | 603875 |
UniProt ID | P32971 |
◆ Recombinant Proteins | ||
Tnfsf8-10626M | Recombinant Mouse Tnfsf8 Protein, 68-239, C-Fc-Avi tagged | +Inquiry |
TNFSF8-60H | Active Recombinant Human TNFSF8, Fc tagged | +Inquiry |
TNFSF8-23H | Recombinant Human TNFSF8 Protein (K78A), His-tagged | +Inquiry |
TNFSF8-2258H | Recombinant Human TNFSF8 Protein, MYC/DDK-tagged | +Inquiry |
Tnfsf8-780M | Recombinant Mouse Tnfsf8 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF8-1053RCL | Recombinant Rat TNFSF8 cell lysate | +Inquiry |
TNFSF8-1190CCL | Recombinant Cynomolgus TNFSF8 cell lysate | +Inquiry |
TNFSF8-3051HCL | Recombinant Human TNFSF8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFSF8 Products
Required fields are marked with *
My Review for All TNFSF8 Products
Required fields are marked with *
0
Inquiry Basket