Species : |
Human |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
211 |
Description : |
Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/mL of TSG. |
Molecular Mass : |
30-33 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
Storage : |
Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |