Active Recombinant Human TWSG1 Protein (211 aa), His-tagged

Cat.No. : TWSG1-162T
Product Overview : Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 211
Description : Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/mL of TSG.
Molecular Mass : 30-33 kDa, observed by reducing SDS-PAGE.
AA Sequence : HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name TWSG1 twisted gastrulation homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol TWSG1
Synonyms TWSG1; twisted gastrulation homolog 1 (Drosophila); twisted gastrulation protein homolog 1; TSG;
Gene ID 57045
mRNA Refseq NM_020648
Protein Refseq NP_065699
MIM 605049
UniProt ID Q9GZX9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TWSG1 Products

Required fields are marked with *

My Review for All TWSG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon