Active Recombinant Human TWSG1 Protein (211 aa), His-tagged
Cat.No. : | TWSG1-162T |
Product Overview : | Recombinant human Twisted Gastrulation (TSG), produced in HEK 293 cells is a polypeptide chain containing 211 amino acids. A fully biologically active molecule, rhTSG has a molecular mass of 30~33 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 211 |
Description : | Twisted gastrulation (TWSG1 or TSG) is a cysteine-rich 24 kDa glycoprotein. It is a secreted BMP binding protein that modulates BMP ligand availability in extracellular space. Human TSG shares 98% aa identity with mouse and rat TSG, and 99.5% aa identity with canine, equine, bovine and porcine TSG. Glycosylation and bioactivity of TWSG1 recombinant proteins vary markedly by cellular source. Non-glycosylated hTWSG1 made in E. coli has both reduced affinity for BMPs, as shown by surface plasmon resonance analysis, and reduced BMP inhibitory activity in a mandibular explant culture system compared to glycosylated proteins made in insect cells or mouse myeloma cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Determined by its ability to neutralize BMP-6 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The ED50 for this effect is < 2 μg/mL of TSG. |
Molecular Mass : | 30-33 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | HHHHHHHHCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human Twisted Gastrulation (TSG), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Twisted Gastrulation should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | TWSG1 twisted gastrulation homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | TWSG1 |
Synonyms | TWSG1; twisted gastrulation homolog 1 (Drosophila); twisted gastrulation protein homolog 1; TSG; |
Gene ID | 57045 |
mRNA Refseq | NM_020648 |
Protein Refseq | NP_065699 |
MIM | 605049 |
UniProt ID | Q9GZX9 |
◆ Recombinant Proteins | ||
TWSG1-729H | Active Recombinant Human TWSG1 | +Inquiry |
Twsg1-850M | Recombinant Mouse Twsg1 Protein, His-tagged | +Inquiry |
TWSG1-1506H | Recombinant Human Twisted Gastrulation Homolog 1 (Drosophila) | +Inquiry |
TWSG1-3783H | Recombinant Human TWSG1 protein, His-tagged | +Inquiry |
Twsg1-9780M | Recombinant Mouse Twsg1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TWSG1-1547MCL | Recombinant Mouse TWSG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TWSG1 Products
Required fields are marked with *
My Review for All TWSG1 Products
Required fields are marked with *
0
Inquiry Basket