Active Recombinant Human VEGF121 Protein (121 aa)
Cat.No. : | VEGFA-301V |
Product Overview : | Recombinant human VEGF-A121 (rhVEGF-A121) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 121 amino acids each. A fully biologically active molecule, rhVEGF-A121 has a molecular mass of 28.2 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 121 |
Description : | VEGF-A121 is one of five isoforms (121, 145, 165, 189, and 206) of VEGF protein, a cytokine belonging to the Platelet Differentiation Growth Factor (PDGF) family, and existing as a disulfide-linked homodimeric glycoprotein. In contrast to the longer isoforms, VEGF-A121 is more freely diffusible, and cannot bind to heparin. In vivo, VEGF is expressed predominantly in lung, heart, kidney, and adrenal glands, and the expression of VEGF is up-regulated by a number of growth factors, including PDGF, Fibroblast Growth Factor (FGF), Epidermal Growth Factor (EGF), and Tumor Necrosis Factor (TNF). VEGF signals via binding to two tyrosine kinase receptors: the Fms-like tyrosine kinase 1 (Flt-1) and the kinase domain receptor (KDR). VEGF is a specific mitogen and survival factor, contributing to abnormal angiogenesis and cancer development. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 ng/mL, measured by a cell proliferation assay using HUVEC Cells, corresponding to a specific activity of > 2 × 10^5 units/mg. |
Molecular Mass : | 28.2 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human VEGF-A121 (rhVEGF-A121) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhVEGF-A121 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens ] |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor, VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609; |
Gene ID | 7422 |
mRNA Refseq | NM_001025366 |
Protein Refseq | NP_001020537 |
MIM | 192240 |
UniProt ID | P15692 |
◆ Recombinant Proteins | ||
VEGFA-50H | Recombinant Human Vascular Endothelial Growth Factor 165 | +Inquiry |
VEGFA-6555H | Recombinant Human VEGFA Protein (Ala27-Arg232), C-His tagged | +Inquiry |
VEGFA-210HAF488 | Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 488 conjugated | +Inquiry |
VEGFA-548HAF488 | Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 488 conjugated | +Inquiry |
VEGFA-302CAF488 | Recombinant Canine VEGFA Protein, None-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-1427HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *
0
Inquiry Basket