Active Recombinant Human VEGF121 Protein (121 aa)

Cat.No. : VEGFA-301V
Product Overview : Recombinant human VEGF-A121 (rhVEGF-A121) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 121 amino acids each. A fully biologically active molecule, rhVEGF-A121 has a molecular mass of 28.2 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 121
Description : VEGF-A121 is one of five isoforms (121, 145, 165, 189, and 206) of VEGF protein, a cytokine belonging to the Platelet Differentiation Growth Factor (PDGF) family, and existing as a disulfide-linked homodimeric glycoprotein. In contrast to the longer isoforms, VEGF-A121 is more freely diffusible, and cannot bind to heparin. In vivo, VEGF is expressed predominantly in lung, heart, kidney, and adrenal glands, and the expression of VEGF is up-regulated by a number of growth factors, including PDGF, Fibroblast Growth Factor (FGF), Epidermal Growth Factor (EGF), and Tumor Necrosis Factor (TNF). VEGF signals via binding to two tyrosine kinase receptors: the Fms-like tyrosine kinase 1 (Flt-1) and the kinase domain receptor (KDR). VEGF is a specific mitogen and survival factor, contributing to abnormal angiogenesis and cancer development.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 ng/mL, measured by a cell proliferation assay using HUVEC Cells, corresponding to a specific activity of > 2 × 10^5 units/mg.
Molecular Mass : 28.2 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human VEGF-A121 (rhVEGF-A121) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhVEGF-A121 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name VEGFA vascular endothelial growth factor A [ Homo sapiens ]
Official Symbol VEGFA
Synonyms VEGFA; vascular endothelial growth factor A; vascular endothelial growth factor, VEGF; VEGF A; VPF; vascular permeability factor; VEGF; MVCD1; MGC70609;
Gene ID 7422
mRNA Refseq NM_001025366
Protein Refseq NP_001020537
MIM 192240
UniProt ID P15692

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VEGFA Products

Required fields are marked with *

My Review for All VEGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon