Active Recombinant Human VEGFA Protein

Cat.No. : VEGFA-01H
Product Overview : Recombinant Human VEGF-165 Protein without tag was expressed in Nicotiana Benthamiana. Animal Component Free. Low endotoxins, prions or virons to risk microbial contamination.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Form : VEGF-165 delivered soluble/frozen carrier-free. Does not contain BSA.
Bio-activity : ED50 = 2.3 ng/mL
Molecular Mass : Recombinant human VEGF-165 produced in plants contains 165 amino acids and has a predicted molecular mass of 19.2 kDa. The predicted mass of the dimer is 38.4 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26.28 kDa in SDS-PAGE.
AA Sequence : APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : Low endotoxins, prions or virons to risk microbial contamination.
Purity : > 95%, as determined by SDS-Page
Stability : Recombinant Proteins are stable for up to 6 months from date of receipt at -20 centigrade, one year at -80 centigrade.
Storage : Until use, Human VEGF-165 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ]
Official Symbol VEGFA
Synonyms VEGFA; vascular endothelial growth factor A; VPF; VEGF; MVCD1; vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular permeability factor
Gene ID 7422
mRNA Refseq NM_003376
Protein Refseq NP_003367
MIM 192240
UniProt ID P15692

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All VEGFA Products

Required fields are marked with *

My Review for All VEGFA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon