Active Recombinant Human VEGFA Protein
Cat.No. : | VEGFA-01H |
Product Overview : | Recombinant Human VEGF-165 Protein without tag was expressed in Nicotiana Benthamiana. Animal Component Free. Low endotoxins, prions or virons to risk microbial contamination. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Form : | VEGF-165 delivered soluble/frozen carrier-free. Does not contain BSA. |
Bio-activity : | ED50 = 2.3 ng/mL |
Molecular Mass : | Recombinant human VEGF-165 produced in plants contains 165 amino acids and has a predicted molecular mass of 19.2 kDa. The predicted mass of the dimer is 38.4 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26.28 kDa in SDS-PAGE. |
AA Sequence : | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
Endotoxin : | Low endotoxins, prions or virons to risk microbial contamination. |
Purity : | > 95%, as determined by SDS-Page |
Stability : | Recombinant Proteins are stable for up to 6 months from date of receipt at -20 centigrade, one year at -80 centigrade. |
Storage : | Until use, Human VEGF-165 should be stored at 4 centigrade between 2-7 days and for future use below -18 centigrade. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Gene Name | VEGFA vascular endothelial growth factor A [ Homo sapiens (human) ] |
Official Symbol | VEGFA |
Synonyms | VEGFA; vascular endothelial growth factor A; VPF; VEGF; MVCD1; vascular endothelial growth factor A; vascular endothelial growth factor A121; vascular endothelial growth factor A165; vascular permeability factor |
Gene ID | 7422 |
mRNA Refseq | NM_003376 |
Protein Refseq | NP_003367 |
MIM | 192240 |
UniProt ID | P15692 |
◆ Recombinant Proteins | ||
VEGFA-156H | Active Recombinant Human VEGF165 | +Inquiry |
Vegfa-2103M | Active Recombinant Mouse Vegfa protein | +Inquiry |
VEGFA-561H | Recombinant Human VEGFA Protein, His-tagged | +Inquiry |
VEGFA-7856H | Recombinant Human VEGFA protein, GST-tagged | +Inquiry |
VEGFA-301246H | Recombinant Human VEGFA protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-647MCL | Recombinant Mouse VEGFA cell lysate | +Inquiry |
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VEGFA Products
Required fields are marked with *
My Review for All VEGFA Products
Required fields are marked with *