Active Recombinant Human VTN protein
Cat.No. : | VTN-239H |
Product Overview : | Recombinant human Vitronectin gene (20-398 aa Fragment) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 20-398 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
Bio-activity : | Functional Test: Each lot was tested with human ES cell (H1) culture using 5-10 µg in 1 ml Nutristem medium per well (6-well plate). |
AA Sequence : | MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQV GGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLK NGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNI SDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFE LLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNS RRPSR |
Purity : | >95% by SDS-PAGE. |
Applications : | 1. As coating matrix protein for maintaining long-term ES or iPS cell culture before combining with E8 culture medium.2. As an excellent coating matrix material of 11R-tagged recombinant TF intracellular delivery for protein derived iPS protocol with extremely low-level non-specific interaction. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | VTN vitronectin [ Homo sapiens ] |
Official Symbol | VTN |
Synonyms | VTN; vitronectin; vitronectin (serum spreading factor, somatomedin B, complement S protein); complement S protein; serum spreading factor; somatomedin B; VN; epibolin; S-protein; complement S-protein; serum-spreading factor; V75; VNT; |
Gene ID | 7448 |
mRNA Refseq | NM_000638 |
Protein Refseq | NP_000629 |
MIM | 193190 |
UniProt ID | P04004 |
Chromosome Location | 17q11.2 |
Pathway | ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Inflammatory Response Pathway, organism-specific biosystem; |
Function | extracellular matrix binding; heparin binding; integrin binding; polysaccharide binding; scavenger receptor activity; |
◆ Recombinant Proteins | ||
VTN-3682H | Recombinant Human VTN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Vtn-576M | Recombinant Mouse Vtn Protein, His-tagged | +Inquiry |
VTN-248H | Recombinant Human VTN, His-tagged | +Inquiry |
VTN-239H | Active Recombinant Human VTN protein | +Inquiry |
VTN-295H | Active Recombinant Human VTN | +Inquiry |
◆ Native Proteins | ||
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
Vtn-683R | Native Rat Vitronectin | +Inquiry |
VTN-31737TH | Native Human VTN | +Inquiry |
VTN-31735TH | Native Human VTN | +Inquiry |
VTN-31736TH | Native Human VTN | +Inquiry |
◆ Cell & Tissue Lysates | ||
VTN-2062MCL | Recombinant Mouse VTN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VTN Products
Required fields are marked with *
My Review for All VTN Products
Required fields are marked with *