Active Recombinant Human VTN protein

• Cat.No.: VTN-239H
• Product Overview: Recombinant human Vitronectin gene (20-398 aa Fragment) was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 20-398 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• Bio-activity: Functional Test: Each lot was tested with human ES cell (H1) culture using 5-10 µg in 1 ml Nutristem medium per well (6-well plate).
• AA Sequence: MDQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQV GGPSLTSDLQAQSKGNPEQTPVLKPEEEAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLK NGSLFAFRGQYCYELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYPRNI SDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSAVFEHFAMMQRDSWEDIFE LLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMAPRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNS RRPSR
• Purity: >95% by SDS-PAGE.
• Applications: 1. As coating matrix protein for maintaining long-term ES or iPS cell culture before combining with E8 culture medium.2. As an excellent coating matrix material of 11R-tagged recombinant TF intracellular delivery for protein derived iPS protocol with extremely low-level non-specific interaction.
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: VTN vitronectin [ Homo sapiens ]
• Official Symbol: VTN
• Synonyms: VTN; vitronectin; vitronectin (serum spreading factor, somatomedin B, complement S protein); complement S protein; serum spreading factor; somatomedin B; VN; epibolin; S-protein; complement S-protein; serum-spreading factor; V75; VNT
• Gene ID: 7448
• mRNA Refseq: NM_000638
• Protein Refseq: NP_000629
• MIM: 193190
• UniProt ID: P04004
• Chromosome Location: 17q11.2
• Pathway: ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem; Inflammatory Response Pathway, organism-specific biosystem
• Function: extracellular matrix binding; heparin binding; integrin binding; polysaccharide binding; scavenger receptor activity