Active Recombinant Macaca fascicularis creatine kinase, His-tagged

Cat.No. : ck-9175M
Product Overview : Recombinant Macaca fascicularis creatine kinase protein, A DNA sequence encoding the full length creatine kinase of Macaca fascicularis corresponding to amino acid (1-381) was expressed with a C-terminal polyhistidine tag in Sf9 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Macaca fascicularis
Source : Sf9 Cells
Tag : His
Protein Length : 381 amino acids
Description : Creatine Kinase (CK) also known as creatine phosphokinase (CPK) and ATP: creatine N-phosphotransferase is a common cellular enzyme (EC 2.7.3.2). It catalyzes the reversible conversion of creatine and ATP into ADP and phosphocreatine. CK is widely expressed in various tissues and cell types, with highest activity in striated muscles, heart tissue and brain. CK consists of two subunits: M (muscle) and B (brain), and has three isoenzymes: CK-MM (skeleton muscle), CK-MB (cardiac muscle), and CK-BB (brain). Increased CK level is associated with many diseases such as myocardial infarction, muscular dystrophy, pulmonary infarction and brain tumors.
Form : liquid. PBS pH7.4, 146mM sucrose, 0.5mM TCEP
Bio-activity : ~106U/mg. Creatine kinase (CK) activity was measured by the production of molybdenum blue at 660nm. Concentrations were expressed U/mg (CK).
Molecular Mass : The recombinant CK consists of 381 amino acids and has a predicted molecular mass of 43kDa. In SDS-PAGE under reducing conditions, it migrates with an apparent molecular mass of 43kDa.
AA Sequence : MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLDLYKKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCV AGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRG ERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNK SFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHV KLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQ SIDDMIPAQK
Purity : >95% as determined by SDS-PAGE
Storage : Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃
Concentration : 0.625 mg/ml

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All creatine kinase Products

Required fields are marked with *

My Review for All creatine kinase Products

Required fields are marked with *

0
cart-icon