Active Recombinant Mouse Adipoq Protein (227 aa)

Cat.No. : Adipoq-443A
Product Overview : Recombinant mouse Adiponectin (rmAdiponectin) produced in E. coli is a single non-glycosylated polypeptide chain containing 227 amino acids. A fully biologically active molecule, rmAdiponectin has a molecular mass of 24.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 227
Description : Adiponectin is a hormone mainly produced by adipocytes. Adiponectin forms a homotrimer and exists as higher order multimers in vivo. The receptors of Adiponectin are seven-transmembrane G protein coupled receptors: Receptor 1 is expressed in skeletal muscle and Receptor 2 in liver. Adiponectin receives a lot of attention because of its anti-diabetic, anti-atherosclerotic, and anti-inflammatory properties. Adiponectin increases the expression of molecules involved in fatty acid transport, combustion of fatty acid, and energy dissipation, and increases insulin sensitivity of the body. Decreased levels of Adiponectin are associated with hypertension, cardiovascular diseases, and metabolic syndromes. Therefore, Adiponectin has promising potential as a pharmacological agent.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 5 μg/mL, measured by a cell growth inhibitory assay using M1 cells, corresponding to a specific activity of > 2 × 10^2 units/mg.
Molecular Mass : 24.6 kDa, observed by reducing SDS-PAGE.
AA Sequence : VTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant mouse Adiponectin (rmAdiponectin) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmAdiponectin remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus ]
Official Symbol Adipoq
Synonyms ADIPOQ; adiponectin, C1Q and collagen domain containing; adiponectin; adipocyte-specific protein AdipoQ; adipocyte complement related protein; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; APN; Acdc; apM1; 30kDa; GBP28; adipo; Acrp30;
Gene ID 11450
mRNA Refseq NM_009605
Protein Refseq NP_033735
UniProt ID Q60994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Adipoq Products

Required fields are marked with *

My Review for All Adipoq Products

Required fields are marked with *

0

Inquiry Basket

cartIcon