Species : |
Mouse |
Source : |
HEK293 |
Description : |
Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. |
Form : |
Lyophilized (0.4 μm filtered) purified protein |
Bio-activity : |
Full-length adiponectin has been shown to activate AMP-activated protein kinase in hepatocyte. It can also activate AMPK in HepG2 human hepatocytes at the concentration of as low as 1.0 μg/mL. In vitro gluconeogenesis assay in primary rat hepatocytes was performed, showing the murine adiponectin derived from mammalian cells can inhibit glucose production. |
AA Sequence : |
EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNDYKDDDDK |
Purity : |
> 98 % as determined by densitometric image analysis |
Applications : |
ELISA; WB; Cell culture and/or animal studies. |
Stability : |
Shelf life: one year from despatch. |
Storage : |
Store lyophilized (preferably in a desiccator) at -20 centigrade and in aliquots at -80 centigrade. Reconstituted antibody can be stored at 4 centigrade for a limited period of time; it does not show decline in activity after two weeks at 4 centigrade. Avoid repeated freezing and thawing. |
Concentration : |
0.5 mg/mL |
Storage Buffer : |
0.05 M Phosphate buffer, 0.075 M NaCl, pH 7.4 |
Reconstitution : |
Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. |