Active Recombinant Mouse Adipoq Protein
Cat.No. : | Adipoq-7152M |
Product Overview : | Recombinant mouse Adipoq protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Description : | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. |
Form : | Lyophilized (0.4 μm filtered) purified protein |
Bio-activity : | Full-length adiponectin has been shown to activate AMP-activated protein kinase in hepatocyte. It can also activate AMPK in HepG2 human hepatocytes at the concentration of as low as 1.0 μg/mL. In vitro gluconeogenesis assay in primary rat hepatocytes was performed, showing the murine adiponectin derived from mammalian cells can inhibit glucose production. |
AA Sequence : | EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNDYKDDDDK |
Purity : | > 98 % as determined by densitometric image analysis |
Applications : | ELISA; WB; Cell culture and/or animal studies. |
Stability : | Shelf life: one year from despatch. |
Storage : | Store lyophilized (preferably in a desiccator) at -20 centigrade and in aliquots at -80 centigrade. Reconstituted antibody can be stored at 4 centigrade for a limited period of time; it does not show decline in activity after two weeks at 4 centigrade. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | 0.05 M Phosphate buffer, 0.075 M NaCl, pH 7.4 |
Reconstitution : | Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. |
Gene Name | Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ] |
Official Symbol | Adipoq |
Synonyms | Adipoq; adiponectin, C1Q and collagen domain containing; a; Ad; ap; APN; Acd; Acr; Acdc; Adid; GBP2; adip; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d |
Gene ID | 11450 |
mRNA Refseq | NM_009605 |
Protein Refseq | NP_033735 |
UniProt ID | Q60994 |
◆ Recombinant Proteins | ||
Adipoq-118M | Recombinant Mouse Adipoq (Trimer), Flag-tagged | +Inquiry |
Adipoq-117M | Recombinant Mouse Adipoq, Globular Domain, His-tagged | +Inquiry |
ADIPOQ-258H | Recombinant Human adiponectin, C1Q and collagen domain containing Protein, Tag Free | +Inquiry |
ACRP30-3197H | Recombinant Human ACRP30 | +Inquiry |
ADIPOQ-1376H | Recombinant Human ADIPOQ Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *
0
Inquiry Basket