Active Recombinant Mouse Adipoq Protein
| Cat.No. : | Adipoq-7152M |
| Product Overview : | Recombinant mouse Adipoq protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Description : | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. |
| Form : | Lyophilized (0.4 μm filtered) purified protein |
| Bio-activity : | Full-length adiponectin has been shown to activate AMP-activated protein kinase in hepatocyte. It can also activate AMPK in HepG2 human hepatocytes at the concentration of as low as 1.0 μg/mL. In vitro gluconeogenesis assay in primary rat hepatocytes was performed, showing the murine adiponectin derived from mammalian cells can inhibit glucose production. |
| AA Sequence : | EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNDYKDDDDK |
| Purity : | > 98 % as determined by densitometric image analysis |
| Applications : | ELISA; WB; Cell culture and/or animal studies. |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store lyophilized (preferably in a desiccator) at -20 centigrade and in aliquots at -80 centigrade. Reconstituted antibody can be stored at 4 centigrade for a limited period of time; it does not show decline in activity after two weeks at 4 centigrade. Avoid repeated freezing and thawing. |
| Concentration : | 0.5 mg/mL |
| Storage Buffer : | 0.05 M Phosphate buffer, 0.075 M NaCl, pH 7.4 |
| Reconstitution : | Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. |
| Gene Name | Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ] |
| Official Symbol | Adipoq |
| Synonyms | Adipoq; adiponectin, C1Q and collagen domain containing; a; Ad; ap; APN; Acd; Acr; Acdc; Adid; GBP2; adip; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d |
| Gene ID | 11450 |
| mRNA Refseq | NM_009605 |
| Protein Refseq | NP_033735 |
| UniProt ID | Q60994 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *
