Active Recombinant Mouse Adipoq Protein

Cat.No. : Adipoq-7152M
Product Overview : Recombinant mouse Adipoq protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Description : Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Form : Lyophilized (0.4 μm filtered) purified protein
Bio-activity : Full-length adiponectin has been shown to activate AMP-activated protein kinase in hepatocyte. It can also activate AMPK in HepG2 human hepatocytes at the concentration of as low as 1.0 μg/mL. In vitro gluconeogenesis assay in primary rat hepatocytes was performed, showing the murine adiponectin derived from mammalian cells can inhibit glucose production.
AA Sequence : EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYMYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNDYKDDDDK
Purity : > 98 % as determined by densitometric image analysis
Applications : ELISA; WB; Cell culture and/or animal studies.
Stability : Shelf life: one year from despatch.
Storage : Store lyophilized (preferably in a desiccator) at -20 centigrade and in aliquots at -80 centigrade.
Reconstituted antibody can be stored at 4 centigrade for a limited period of time; it does not show decline in activity after two weeks at 4 centigrade.
Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL
Storage Buffer : 0.05 M Phosphate buffer, 0.075 M NaCl, pH 7.4
Reconstitution : Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely.
Gene Name Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ]
Official Symbol Adipoq
Synonyms Adipoq; adiponectin, C1Q and collagen domain containing; a; Ad; ap; APN; Acd; Acr; Acdc; Adid; GBP2; adip; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
Gene ID 11450
mRNA Refseq NM_009605
Protein Refseq NP_033735
UniProt ID Q60994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Adipoq Products

Required fields are marked with *

My Review for All Adipoq Products

Required fields are marked with *

0
cart-icon
0
compare icon