Active Recombinant Mouse Adipoq Protein, His-tagged
Cat.No. : | Adipoq-033M |
Product Overview : | Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq) with a N-His tag was expressed in Hi-5 insect. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Description : | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. |
Bio-activity : | Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0ug/mL. |
Molecular Mass : | 35 kDa |
AA Sequence : | RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ] |
Official Symbol | Adipoq |
Synonyms | Adipoq; adiponectin, C1Q and collagen domain containing; Ad; APN; Acdc; Adid; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d |
Gene ID | 11450 |
mRNA Refseq | NM_009605 |
Protein Refseq | NP_033735 |
UniProt ID | Q60994 |
◆ Recombinant Proteins | ||
ADIPOQ-856H | Recombinant Human ADIPOQ protein, Flag-tagged | +Inquiry |
ADIPOQ-209H | Recombinant Human ADIPOQ, His-tagged | +Inquiry |
ADIPOQ-0010C | Recombinant Chicken ADIPOQ Protein (Ser105-Arg244), C-His-tagged | +Inquiry |
ADIPOQ-7301H | Recombinant Human ADIPOQ protein, Fc-tagged | +Inquiry |
Adipoq-034M | Active Recombinant Mouse Adipoq Protein | +Inquiry |
◆ Native Proteins | ||
ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *
0
Inquiry Basket