Active Recombinant Mouse Adipoq Protein, His-tagged
| Cat.No. : | Adipoq-033M |
| Product Overview : | Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq) with a N-His tag was expressed in Hi-5 insect. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Description : | Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. |
| Bio-activity : | Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 4.0-6.0ug/mL. |
| Molecular Mass : | 35 kDa |
| AA Sequence : | RGHHHHHHHHVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN |
| Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
| Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
| Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
| Gene Name | Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ] |
| Official Symbol | Adipoq |
| Synonyms | Adipoq; adiponectin, C1Q and collagen domain containing; Ad; APN; Acdc; Adid; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d |
| Gene ID | 11450 |
| mRNA Refseq | NM_009605 |
| Protein Refseq | NP_033735 |
| UniProt ID | Q60994 |
| ◆ Recombinant Proteins | ||
| Adipoq-194R | Recombinant Rat Adipoq protein, His-tagged | +Inquiry |
| Adipoq-204M | Recombinant Mouse Adipoq protein, His-tagged | +Inquiry |
| Adipoq-5596M | Recombinant Mouse Adipoq Protein (Glu18-Asn247), C-His tagged | +Inquiry |
| ADIPOQ-4956H | Active Recombinant Human Adiponectin, C1Q And Collagen Domain Containing | +Inquiry |
| Adipoq-195R | Recombinant Rat Adipoq, FLAG-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
| ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *
