Active Recombinant Mouse BAFF Protein, His-Tagged

Cat.No. : BAFF-01M
Product Overview : Recombinant mouse BAFF Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : B-cell activating factor (BAFF) also known as tumor necrosis factor ligand superfamily member 13B is a protein, that in humans, is encoded by the TNFSF13B gene. BAFF is also known as B Lymphocyte Stimulator (BLyS) and TNF- and APOL-related leukocyte expressed ligand (TALL-1) and the Dendritic cell-derived TNF-like molecule. BAFF is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells.
Form : Lyophilized powder
AA Sequence : MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFF
IYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce proliferation in mouse B cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10^6 IU/mg.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Tnfsf13b tumor necrosis factor (ligand) superfamily, member 13b [ Mus musculus (house mouse) ]
Official Symbol BAFF
Synonyms BAFF; BLyS; TALL1; THANK; zTNF4; TALL-1; Tnlg7a; TNFSF20; D8Ertd387e
Gene ID 24099
mRNA Refseq NM_001347309.1
Protein Refseq NP_001334238.1
UniProt ID Q9WU72

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAFF Products

Required fields are marked with *

My Review for All BAFF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon