Active Recombinant Mouse BAFF Protein, His-Tagged

• Cat.No.: BAFF-01M
• Product Overview: Recombinant mouse BAFF Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: B-cell activating factor (BAFF) also known as tumor necrosis factor ligand superfamily member 13B is a protein, that in humans, is encoded by the TNFSF13B gene. BAFF is also known as B Lymphocyte Stimulator (BLyS) and TNF- and APOL-related leukocyte expressed ligand (TALL-1) and the Dendritic cell-derived TNF-like molecule. BAFF is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells.
• Form: Lyophilized powder
• AA Sequence: MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFF
  IYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce proliferation in mouse B cells. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10^6 IU/mg.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Tnfsf13b tumor necrosis factor (ligand) superfamily, member 13b [ Mus musculus (house mouse) ]
• Official Symbol: BAFF
• Synonyms: BAFF; BLyS; TALL1; THANK; zTNF4; TALL-1; Tnlg7a; TNFSF20; D8Ertd387e
• Gene ID: 24099
• mRNA Refseq: NM_001347309.1
• Protein Refseq: NP_001334238.1
• UniProt ID: Q9WU72