Active Recombinant Mouse Cd27l Protein, His-Tagged

Cat.No. : Cd27l-01M
Product Overview : Recombinant mouse Cd27l Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : CD27 Ligand, which belongs to the TNF superfamily, is a type II transmembrane protein. Like NK cells, CD27L is also located in activated T and B lymphocytes. Along with NK enhancement, CD27L and its receptor regulate the immune response by raising expansion and differentiation of T cell. CD27 signaling can act like a co-stimulatory effector to sustain survival of the CD8+ T cells, mainly by increasing expression of the IL-2 gene.
Form : Lyophilized powder
AA Sequence : QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPA
AHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <4.5 μg/mL.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Cd70 CD70 antigen [ Mus musculus (house mouse) ]
Official Symbol Cd27l
Synonyms Cd70; CD27LG; Tnfsf7; Tnlg8a
Gene ID 21948
mRNA Refseq NM_011617.2
Protein Refseq NP_035747.1
UniProt ID O55237

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cd27l Products

Required fields are marked with *

My Review for All Cd27l Products

Required fields are marked with *

0

Inquiry Basket

cartIcon