Active Recombinant Mouse Cd27l Protein, His-Tagged

• Cat.No.: Cd27l-01M
• Product Overview: Recombinant mouse Cd27l Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: CD27 Ligand, which belongs to the TNF superfamily, is a type II transmembrane protein. Like NK cells, CD27L is also located in activated T and B lymphocytes. Along with NK enhancement, CD27L and its receptor regulate the immune response by raising expansion and differentiation of T cell. CD27 signaling can act like a co-stimulatory effector to sustain survival of the CD8+ T cells, mainly by increasing expression of the IL-2 gene.
• Form: Lyophilized powder
• AA Sequence: QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPA
  AHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <4.5 μg/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Cd70 CD70 antigen [ Mus musculus (house mouse) ]
• Official Symbol: Cd27l
• Synonyms: Cd70; CD27LG; Tnfsf7; Tnlg8a
• Gene ID: 21948
• mRNA Refseq: NM_011617.2
• Protein Refseq: NP_035747.1
• UniProt ID: O55237