Active Recombinant Mouse Cd27l Protein, His-Tagged
Cat.No. : | Cd27l-01M |
Product Overview : | Recombinant mouse Cd27l Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | CD27 Ligand, which belongs to the TNF superfamily, is a type II transmembrane protein. Like NK cells, CD27L is also located in activated T and B lymphocytes. Along with NK enhancement, CD27L and its receptor regulate the immune response by raising expansion and differentiation of T cell. CD27 signaling can act like a co-stimulatory effector to sustain survival of the CD8+ T cells, mainly by increasing expression of the IL-2 gene. |
Form : | Lyophilized powder |
AA Sequence : | QQQRLLEHPEPHTAELQLNLTVPRKDPTLRWGAGPALGRSFTHGPELEEGHLRIHQDGLYRLHIQVTLANCSSPGSTLQHRATLAVGICSPA AHGISLLRGRFGQDCTVALQRLTYLVHGDVLCTNLTLPLLPSRNADETFFGVQWICP with polyhistidine tag at the N-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce proliferation in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is <4.5 μg/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Cd70 CD70 antigen [ Mus musculus (house mouse) ] |
Official Symbol | Cd27l |
Synonyms | Cd70; CD27LG; Tnfsf7; Tnlg8a |
Gene ID | 21948 |
mRNA Refseq | NM_011617.2 |
Protein Refseq | NP_035747.1 |
UniProt ID | O55237 |
◆ Recombinant Proteins | ||
CD27-098H | Active Recombinant Human CD27 Protein, hIgG-His-Tagged | +Inquiry |
Cd27l-01M | Active Recombinant Mouse Cd27l Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd27l Products
Required fields are marked with *
My Review for All Cd27l Products
Required fields are marked with *