Active Recombinant Mouse Csf1 Protein (156 aa)

• Cat.No.: Csf1-334C
• Product Overview: Recombinant mouse Macrophage Colony Stimulating Factor (M-CSF) produced in E. coli is a disulfide-linked homodimer containing two non-glycosylated polypeptide chains of 156 amino acids each. A fully biologically active molecule, rmM-CSF has a molecular mass of 30 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 156
• Description: Macrophage Colony Stimulating Factor (M-CSF),also known as CSF1,is a potent hematopoietic factor produced by a variety of cells including lymphocytes, monocytes, fibroblasts, endothelial cells, myoblasts and osteoblasts. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. It is a key regulator of cellular proliferation, differentiation, and survival of blood monocytes, tissue macrophages and their progenitor cells.M-CSF affects macrophages and monocytes in several ways, including stimulating increased phagocytic and chemotactic activity, and increased tumour cell cytotoxicity.M-CSF is clinically used in the treatment of infection, malignancies and atherosclerosis. It facilitates hematopoietic recovery after bone marrow transplantation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 3 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 3.3 × 10^5 units/mg.
• Molecular Mass: 30 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Mouse Macrophage Colony Stimulating Factor(M-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse M-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against 50mMTris,150mMNaCl, pH 8.0.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Csf1 colony stimulating factor 1 (macrophage) [ Mus musculus ]
• Official Symbol: Csf1
• Synonyms: CSF1; colony stimulating factor 1 (macrophage); macrophage colony-stimulating factor 1; osteopetrosis; op; Csfm; MCSF; C87615
• Gene ID: 12977
• mRNA Refseq: NM_001113529
• Protein Refseq: NP_001107001
• UniProt ID: P07141