Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
156 |
Description : |
Macrophage Colony Stimulating Factor (M-CSF),also known as CSF1,is a potent hematopoietic factor produced by a variety of cells including lymphocytes, monocytes, fibroblasts, endothelial cells, myoblasts and osteoblasts. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. It is a key regulator of cellular proliferation, differentiation, and survival of blood monocytes, tissue macrophages and their progenitor cells.M-CSF affects macrophages and monocytes in several ways, including stimulating increased phagocytic and chemotactic activity, and increased tumour cell cytotoxicity.M-CSF is clinically used in the treatment of infection, malignancies and atherosclerosis. It facilitates hematopoietic recovery after bone marrow transplantation. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50< 3 ng/mL, measured in a cell proliferation assay using Murine M-NFS-60 cells, corresponding to a specific activity of > 3.3 × 10^5 units/mg. |
Molecular Mass : |
30 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant Mouse Macrophage Colony Stimulating Factor(M-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse M-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against 50mMTris,150mMNaCl, pH 8.0. |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |