Active Recombinant Full Length Mouse Csf2 Protein, Tag Free

• Cat.No.: Csf2-9789M
• Product Overview: Active Recombinant Full Length Mouse Csf2 Protein without tag was expressed in CHO.

Specification

• Species: Mouse
• Source: CHO
• Tag: Non
• Protein Length: 18-141 aa
• Description: GM-CSF Protein, Mouse (CHO) is a hematopoietic growth factor and immune modulator.
• Form: Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
• Bio-activity: 1. The ED50 is 21.54 pg/mL as measured by mouse FDC-P1 cells, corresponding to a specific activity of 4.643 × 10^7 units/mg. 2. Measured in a cell proliferation assay using THP 1 cells. The ED50 for this effect is 21.54 pg/mL, corresponding to a specific activity is 4.643×10^7 units/mg. 3. Measured by its binding ability in a functional ELISA. Immobilized Mouse GM-CSF at 5 μg/mL (100 μL/well) on the plate can bind Mouse GM-CSF R alpha. The ED50 for this effect is 0.1155 μg/mL.
• Molecular Mass: 14.2 kDa
• AASequence: APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQK
• Endotoxin: < 0.2 EU/μg by LAL
• Purity: ≥ 95%, as determined by reducing SDS-PAGE.
• Storage: Stored at -20 centigrade for 2 years from date of receipt. After reconstitution, it is stable at 4 centigrade for 1 week or -20 centigrade for longer (with carrier protein). It is recommended to freeze aliquots at -20 or -80 centigrade for extended storage.
• Shipping: Room temperature in continental US; may vary elsewhere.
• Reconstitution: It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Gene Information

• Gene Name: Csf2 colony stimulating factor 2 (granulocyte-macrophage) [ Mus musculus ]
• Official Symbol: Csf2
• Synonyms: CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; CSF; put. GM-CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor 2; Csfgm; GMCSF; Gm-CSf; MGI-IGM; MGC151255; MGC151257
• Gene ID: 12981
• mRNA Refseq: NM_009969
• Protein Refseq: NP_034099
• UniProt ID: Q14AD9