| Species : |
Mouse |
| Source : |
CHO |
| Protein Length : |
78 |
| Description : |
SDF-1 α and SDF-1 β, members of the chemokine α subfamily that lack the ELR domain, were initially identified using the signal sequence trap cloning strategy from a mouse bone-marrow stromal cell line. SDF-1 α and SDF-1 β cDNAs encode precursor proteins of 89 and 93 amino acid residues, respectively. Both SDF-1 α and SDF-1 β are encoded by a single gene and arise by alternative splicing. The two proteins are identical except for the four amino acid residues that are present in the carboxy-terminus of SDF-1 β and absent from SDF-1 α. SDF-1/PBSF is highly conserved between species, with only one amino acid substitution between the mature human and mouse proteins. SDF-1/PBSF acts via the chemokine receptor CXCR4 and has been shown to be a chemoattractant for T-lymphocytes, monocytes, pro- and pre-B cells, but not neutrophils. Mice lacking SDF-1 or CXCR4 have been found to have impaired B-lymphopoiesis, myelopoiesis, vascular development, cardiogenesis and abnormal neuronal cell migration and patterning in the central nervous system. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
The EC50 value of mouse SDF-1/CXCL12 on Ca^2+ mobilization assay in CHO-K1/Gα15/mCXCR4 cells (human Gα15 and mCXCR4 stably expressed in CHO-K1 cells) is less than 2.5 μg/mL. |
| Molecular Mass : |
8.5 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE. |
| Storage : |
Lyophilized recombinant Mouse SDF-1 β/CXCL12 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse SDF-1β/CXCL12 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |