Active Recombinant Mouse Fgf1 Protein

Cat.No. : Fgf1-057M
Product Overview : Purified recombinant protein of Mouse fibroblast growth factor 1 (Fgf1) without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Broad expression in lung adult (RPKM 20.2), heart adult (RPKM 15.2) and 16 other tissues.
Bio-activity : Assay #1: ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of heparin is less than or equal to 0.5 ng/ml corresponding to a specific activity of > 2 x 10^6 units/mg. Assay #2: ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is less than or equal to 0.2 ng/ml in the presence of 10 ug/mL heparin, corresponding to a specific activity of > 5 x 10^6 units/mg.
Molecular Mass : 15.9 kDa
AA Sequence : MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Fgf1 fibroblast growth factor 1 [ Mus musculus (house mouse) ]
Official Symbol Fgf1
Synonyms Fgf1; fibroblast growth factor 1; Fam; Fgfa; Dffrx; Fgf-1; fibroblast growth factor 1; HBGF-1; aFGF; acidic fibroblast growth factor; fibroblast growth factor 1 (acidic); heparin-binding growth factor 1
Gene ID 14164
mRNA Refseq NM_010197
Protein Refseq NP_034327
UniProt ID P61148

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf1 Products

Required fields are marked with *

My Review for All Fgf1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon