Active Recombinant Mouse Fgf9 Protein

Name: Active Recombinant Mouse Fgf9 Protein
SKU: Fgf9-286F

Specification
Gene Information
Related Products
Download

Species :	Mouse
Source :	CHO
Description :	Fibroblast Growth Factor-9 (FGF-9), also known as Glia-activating factor (GAF) and HBGF-9, belongs to the heparin-binding growth factors family. It is a secreted protein that exists as monomer or homodimer. It interacts with FGFR-1, FGFR-2, FGFR-3, and FGFR-4 and plays an important role in regulating cell proliferation, differentiation and migration. It is reported that FGF-9 may be involved in glial cell growth and differentiation during development, gliosis during brain tissue regeneration, and glial tumor growth stimulation. Other reports indicate that FGF-9 plays a role in male development.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 2 ng/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass :	~28 kDa, observed by reducing SDS-PAGE.
AA Sequence :	LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE and HPLC.
Storage :	Lyophilized recombinant Murine Fibroblast Growth Factor-9 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Fibroblast Growth Factor-9should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	Fgf9 fibroblast growth factor 9 [ Mus musculus ]
Official Symbol	Fgf9
Synonyms	FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks;
Gene ID	14180
mRNA Refseq	NM_013518
Protein Refseq	NP_038546
UniProt ID	P54130