Active Recombinant Mouse Fgf9 Protein
Cat.No. : | Fgf9-286F |
Product Overview : | Recombinant Mouse Fgf9 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Fibroblast Growth Factor-9 (FGF-9), also known as Glia-activating factor (GAF) and HBGF-9, belongs to the heparin-binding growth factors family. It is a secreted protein that exists as monomer or homodimer. It interacts with FGFR-1, FGFR-2, FGFR-3, and FGFR-4 and plays an important role in regulating cell proliferation, differentiation and migration. It is reported that FGF-9 may be involved in glial cell growth and differentiation during development, gliosis during brain tissue regeneration, and glial tumor growth stimulation. Other reports indicate that FGF-9 plays a role in male development. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2 ng/mL, measured in a cell proliferation assay using 3T3 cells. |
Molecular Mass : | ~28 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | LGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Murine Fibroblast Growth Factor-9 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Murine Fibroblast Growth Factor-9should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Fgf9 fibroblast growth factor 9 [ Mus musculus ] |
Official Symbol | Fgf9 |
Synonyms | FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; elbow knee synostosis; glia activating factor; glia-activating factor; Eks; |
Gene ID | 14180 |
mRNA Refseq | NM_013518 |
Protein Refseq | NP_038546 |
UniProt ID | P54130 |
◆ Recombinant Proteins | ||
FGF9-406F | Active Recombinant Human FGF9 Protein (208 aa) | +Inquiry |
FGF9-3021H | Recombinant Human FGF9 Protein (Met1-Ser208) | +Inquiry |
FGF9-4117H | Recombinant Human FGF9 Protein, GST-tagged | +Inquiry |
Fgf9-669M | Recombinant Mouse Fgf9 protein | +Inquiry |
FGF9-95M | Active Recombinant Mouse FGF9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF9-001CCL | Recombinant Canine FGF9 cell lysate | +Inquiry |
FGF9-2955HCL | Recombinant Human FGF9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf9 Products
Required fields are marked with *
My Review for All Fgf9 Products
Required fields are marked with *
0
Inquiry Basket