Active Recombinant Mouse Hgf Protein
Cat.No. : | Hgf-4731M |
Product Overview : | Mouse Hgf (Q08048) full length recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | Non |
Description : | This gene encodes a protein that binds to the hepatocyte growth factor receptor to regulate cell growth, cell motility and morphogenesis in numerous cell and tissue types. The encoded preproprotein is proteolytically processed to generate multiple protein products, including the hepatocyte growth factor alpha and beta chains, which heterodimerize to form the mature active protein. Although this protein is a member of the peptidase S1 family of serine proteases, it lacks peptidase activity. Homozygous knockout mice for this gene exhibit embryonic lethality due to impaired development of the placenta and liver. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015] |
Form : | Lyophilized |
Bio-activity : | Determined by the dose-dependent stimulation of the proliferation of mouse IMCD3 cells using a concentration range of 10-20 ng/mL. |
AA Sequence : | alpha chain: QKKRRNTLHEFKKSAKTTLTKEDPLLKIKTKKVNSADECANRCIRNRGFTFTCKAFVFDKSRKRCYWYPFNSMSSGVKKGFGHEFDLYENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDQQTPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKTCAHSAVNETDVPMETTECIQGQGEGYRGTSNTIWNGIPCQRWDSQYPHKHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVISCAKTKQLR Beta chain: VVNGIPTQTTVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESELCAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKVILTYKL |
Endotoxin : | Endotoxin level is < 0.1 ng/μg (< 1 EU/μg). |
Purity : | 95% |
Applications : | Functional Study SDS-PAGE |
Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage : | Store at -2 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Full Length : | Full L. |
Gene Name | Hgf hepatocyte growth factor [ Mus musculus ] |
Official Symbol | Hgf |
Synonyms | HGF; hepatocyte growth factor; SF; scatter factor; hepatopoeitin-A; hepatopoietin-A; NK1; NK2; HGF/SF; SF/HGF; C230052L06Rik; |
Gene ID | 15234 |
mRNA Refseq | NM_010427 |
Protein Refseq | NP_034557 |
◆ Recombinant Proteins | ||
Hgf-8664MAF647 | Recombinant Mouse Hgf Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
HGF-267H | Active Recombinant Human HGF Protein | +Inquiry |
HGF-1045CAF555 | Recombinant Canine HGF Protein, Alexa Fluor 555 conjugated | +Inquiry |
HGF-115H | Recombinant Active Human HGF Protein, Tag Free | +Inquiry |
HGF-114H | Recombinant Active Human HGF Protein, Tag Free | +Inquiry |
◆ Native Proteins | ||
HGF-29231TH | Native Human HGF | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
HGF-38P | Native Porcine HGF | +Inquiry |
◆ Cell & Tissue Lysates | ||
HGF-1210MCL | Recombinant Mouse HGF cell lysate | +Inquiry |
HGF-001HCL | Recombinant Human HGF cell lysate | +Inquiry |
HGF-1077CCL | Recombinant Cynomolgus HGF cell lysate | +Inquiry |
HGF-1233RCL | Recombinant Rat HGF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hgf Products
Required fields are marked with *
My Review for All Hgf Products
Required fields are marked with *
0
Inquiry Basket