Active Recombinant Mouse IFN alpha 1a Protein, His-Tagged

• Cat.No.: IFN alpha 1a-01M
• Product Overview: Recombinant mouse IFN alpha 1a Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interferon alpha-1 or interferon alpha-D, encoded by the human IFNA1gene, is a member of the type I interferon family . It is expressed in peripheral blood leukocytes and lymphoblastoid cells. There are four highly conserved cysteine residues which form two disulfide bonds. One bond is a necessity for biological activity, which plays an critical role in conducting non-specific resistance against a variety of viral infections, and regulation of cell proliferation and modulates immune responses.
• Form: Lyophilized powder
• AA Sequence: CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQ
  LNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK with polyhistidine tag at the N-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to protect L929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <10 pg/mL. The specific activity of recombinant mouse IFN alpha 1a is > 4 x 10^7 IU/mg.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.