Active Recombinant Mouse IFN beta 1a Protein, His-Tagged

• Cat.No.: IFN beta 1a-01M
• Product Overview: Recombinant mouse IFN beta 1a Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interferon-beta is, a cytokine, released by fibroblasts and pathogen-exposed dendritic cells, macrophages, and endothelial cells. IFN beta 1a conducts through the heterodimeric IFN-alpha/beta Receptor. IFN-beta-deficient mice are easier to suffer from experimental autoimmune encephalomyelitis (EAE), a disease model of human multiple sclerosis (MS).In addition, IFN-beta has been proved to suppress the Th17 cell response in both MS and EAE and is usually used to treat MS disease.
• Form: Lyophilized powder
• AA Sequence: MINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNFSSTGWNETIVVRLLDELHQQTVF
  LKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to protect HeLa cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 pg/mL. The specific activity of recombinant mouse IFN beta 1a is > 1 x 10^9 IU/mg.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.