Active Recombinant Mouse Ifng Protein (134 aa)

• Cat.No.: Ifng-379I
• Product Overview: Recombinant mouse IFN gamma (rmIFN-γ) produced in E. coli is a non-glycosylated polypeptide chain of 134 amino acids. A fully biologically active molecule, rmIFN--γ has a molecular mass of 15 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary refolding and chromatographic techniques.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 134
• Description: Sharing 41% sequence identity with human Interferon gamma (hIFN--γ), mouse IFN gamma (mIFN--γ)is a macrophage-activating factor.The active form of IFN--γ is an antiparallel dimer that sets off IFN--γ/JAK/STAT pathway. IFN--γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity.While IFN--γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN--γ is also implicated in resistance to NK cell and CTL responses and in immune escape in avariety of cancers.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50< 0.15 ng/mL, measured by cytotoxicity assay using WEHI-279 cells.
• Molecular Mass: 15 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
• Endotoxin: < 1 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by reducing SDS-PAGE.
• Storage: Lyophilized recombinant mouse IFN gamma (rmIFN-γ) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIFN-γ should be stable up to 1week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: Ifng interferon gamma [ Mus musculus ]
• Official Symbol: Ifng
• Synonyms: IFNG; interferon gamma; IFN-gamma; gamma interferon; Ifg; IFN-g
• Gene ID: 15978
• mRNA Refseq: NM_008337
• Protein Refseq: NP_032363
• UniProt ID: P01580