Active Recombinant Mouse Igf1 Protein (71 aa)
| Cat.No. : | Igf1-375I |
| Product Overview : | Recombinant mouse Insulin-like Growth Factor I (rmIGF-I) produced in E. coli is a single non-glycosylated polypeptide chain containing 71 amino acids. A fully biologically active molecule, rmIGF-I has a molecular mass of 7.8kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 71 |
| Description : | Insulin-like Growth Factor I (IGF-I) is a single chain 7 kDa growth-promoting polypeptide originally identified as somatomedin-c. It belongs to the IGF family of peptides, which also includes IGF-II and insulin. The gene expression of IGF-I is mainly regulated by Growth Hormone, and IGF-I executes its functions via signaling through transmembrane tyrosine receptors (IGF Receptors). Most circulating IFG-I is associated with the IGF Binding Protein 3 (IGFBP-3), and the IGFBPs may inhibit the actions of IGFs by competing against the IGF Receptors. IGF-I is active in post-natal and adult animals, and is crucial for somatic growth, as IGF-I null mice show marked retardation in utero. IGF-I is involved in carcinogenesis, and related to prostate cancer as well. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 10 ng/mL, measured by a cell proliferation assay using FDC-P1 cells, corresponding to a specific activity of >1 × 10^5 units/mg. |
| Molecular Mass : | 7.8 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | MGPETLCGAELVDALQFVCGPRGFYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAA |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% by SDS-PAGE analysis. |
| Storage : | Lyophilized recombinant mouse Insulin-like Growth Factor I (rmIGF-I) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmIGF-I remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
| Gene Name | Igf1 insulin-like growth factor 1 [ Mus musculus ] |
| Official Symbol | Igf1 |
| Synonyms | IGF1; insulin-like growth factor 1; insulin-like growth factor I; somatomedin; Igf-1; Igf-I; C730016P09Rik; |
| Gene ID | 16000 |
| mRNA Refseq | NM_001111274 |
| Protein Refseq | NP_001104744 |
| UniProt ID | P05017 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Igf1 Products
Required fields are marked with *
My Review for All Igf1 Products
Required fields are marked with *



