Active Recombinant Mouse Il10 Protein
Cat.No. : | Il10-261I |
Product Overview : | Recombinant Mouse Il10 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Description : | Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.2 ng/mL, measured in a cell proliferation assay using MC/9 cells. |
Molecular Mass : | 21-23 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il10 interleukin 10 [ Mus musculus ] |
Official Symbol | Il10 |
Synonyms | IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10; |
Gene ID | 16153 |
mRNA Refseq | NM_010548 |
Protein Refseq | NP_034678 |
UniProt ID | P18893 |
◆ Recombinant Proteins | ||
IL10-2033H | Recombinant Human IL10 Protein, His-tagged | +Inquiry |
IL10-79P | Recombinant Porcine Interleukin 10 | +Inquiry |
Il10-6142M | Recombinant Mouse Il10 protein, GST-tagged | +Inquiry |
IL10-372H | Active Recombinant Human IL10 protein, His-tagged | +Inquiry |
Il10-995M | Recombinant Mouse Il10 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il10 Products
Required fields are marked with *
My Review for All Il10 Products
Required fields are marked with *
0
Inquiry Basket