Active Recombinant Mouse Il10 Protein

Name: Active Recombinant Mouse Il10 Protein
SKU: Il10-261I

Specification
Gene Information
Related Products
Download

Species :	Mouse
Source :	CHO
Description :	Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with the Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF, by activated macrophages and Th2 cells. It also displays the ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 0.2 ng/mL, measured in a cell proliferation assay using MC/9 cells.
Molecular Mass :	21-23 kDa, observed by reducing SDS-PAGE.
AA Sequence :	SRGQYSREDNNCTHFPVGQSHMLLELRTAFSQVKTFFQTKDQLDNILLTDSLMQDFKGYLGCQALSEMIQFYLVEVMPQAEKHGPEIKEHLNSLGEKLKTLRMRLRRCHRFLPCENKSKAVEQVKSDFNKLQDQGVYKAMNEFDIFINCIEAYMMIKMKS
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE and HPLC.
Storage :	Lyophilized recombinant murine Interleukin-10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, murine Interleukin-10 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	Il10 interleukin 10 [ Mus musculus ]
Official Symbol	Il10
Synonyms	IL10; interleukin 10; interleukin-10; cytokine synthesis inhibitory factor; CSIF; Il-10;
Gene ID	16153
mRNA Refseq	NM_010548
Protein Refseq	NP_034678
UniProt ID	P18893