Active Recombinant Mouse Il17a Protein (133 aa)
Cat.No. : | Il17a-253I |
Product Overview : | Recombinant murine IL-17A is a 15-20kDa glycosylated cytokine of 133 amino acid polypeptide chain that plays an important role in antimicrobial and chronic inflammation. IL-17 exhibits multiple biological activities on a variety of cells including the induction of IL-6 and IL-8 production in fibroblasts, the enhancement of surface expression of ICAM-1 in fibroblasts, activation of NF-κB and costimulation of T cell proliferation. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Protein Length : | 133 |
Description : | Interleukin-17A, (also known as CTLA-8) is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. cDNA clones encoding IL-17 have been isolated from activated rat, mouse and human T cells. IL-17 represents a family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Measured by its ability to induce IL-1a, IL-4 and IL-6 production by primary mouse splenocytes. |
Molecular Mass : | 15-22 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Murine Interleukin-17A (IL-17A) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant murine IL-17A should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il17a interleukin 17A [ Mus musculus ] |
Official Symbol | Il17a |
Synonyms | IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A; |
Gene ID | 16171 |
mRNA Refseq | NM_010552 |
Protein Refseq | NP_034682 |
UniProt ID | Q62386 |
◆ Recombinant Proteins | ||
IL17A-3092R | Recombinant Rhesus macaque IL17A protein, GST-tagged | +Inquiry |
Il17a-12M | Recombinant Mouse Il17a | +Inquiry |
Il17a-01M | Active Recombinant Mouse Il17a Protein, His-Tagged | +Inquiry |
IL17A-279H | Recombinant Human Interleukin 17A, Fc Chimera | +Inquiry |
IL17A-26H | Recombinant Human Interleukin-17 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il17a Products
Required fields are marked with *
My Review for All Il17a Products
Required fields are marked with *
0
Inquiry Basket