Active Recombinant Mouse Il17a Protein (133 aa)
| Cat.No. : | Il17a-253I |
| Product Overview : | Recombinant murine IL-17A is a 15-20kDa glycosylated cytokine of 133 amino acid polypeptide chain that plays an important role in antimicrobial and chronic inflammation. IL-17 exhibits multiple biological activities on a variety of cells including the induction of IL-6 and IL-8 production in fibroblasts, the enhancement of surface expression of ICAM-1 in fibroblasts, activation of NF-κB and costimulation of T cell proliferation. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | CHO |
| Protein Length : | 133 |
| Description : | Interleukin-17A, (also known as CTLA-8) is a T cell-expressed pleiotropic cytokine that exhibits a high degree of homology to a protein encoded by the ORF13 gene of herpesvirus Saimiri. cDNA clones encoding IL-17 have been isolated from activated rat, mouse and human T cells. IL-17 represents a family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | Measured by its ability to induce IL-1a, IL-4 and IL-6 production by primary mouse splenocytes. |
| Molecular Mass : | 15-22 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE. |
| Storage : | Lyophilized recombinant Murine Interleukin-17A (IL-17A) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant murine IL-17A should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | Il17a interleukin 17A [ Mus musculus ] |
| Official Symbol | Il17a |
| Synonyms | IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A; |
| Gene ID | 16171 |
| mRNA Refseq | NM_010552 |
| Protein Refseq | NP_034682 |
| UniProt ID | Q62386 |
| ◆ Recombinant Proteins | ||
| IL17A-48H | Recombinant Human IL17A Protein | +Inquiry |
| IL17A-5633H | Recombinant Human IL17A protein, His-Avi-tagged, Biotinylated | +Inquiry |
| IL17A-26H | Recombinant Human Interleukin-17 | +Inquiry |
| IL17A-96C | Recombinant Canine IL-17A | +Inquiry |
| IL17A-236B | Recombinant Bovine Interleukin 17A | +Inquiry |
| ◆ Native Proteins | ||
| IL17A-048H | Active Glycosylated Recombinant Human IL17A Homodimer | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il17a Products
Required fields are marked with *
My Review for All Il17a Products
Required fields are marked with *
