Active Recombinant Mouse IL1a Protein, His-Tagged

Cat.No. : IL1a-01M
Product Overview : Recombinant human IL1a protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Interleukin 1 alpha (IL-1α) also known as hematopoietin 1 is a cytokine of the interleukin 1 family that in humans is encoded by the IL1A gene. IL-1α is produced mainly by activated macrophages, as well as neutrophils, epithelial cells, and endothelial cells. It possesses metabolic, physiological, haematopoietic activities, and plays one of the central roles in the regulation of the immune responses. It binds to the interleukin-1 receptor. It is on the pathway that activates tumor necrosis factor-alpha.
Form : Lyophilized powder
AA Sequence : MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGED
QPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS with His tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is <5 pg/mL. The specific activity of recombinant mouse IL-1 alpha is > 2 x 108 IU/mg.
Purity : >95% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Il1a interleukin 1 alpha [ Mus musculus (house mouse) ]
Official Symbol Il1a
Synonyms Il-1a
Gene ID 16175
mRNA Refseq NM_010554.4
Protein Refseq NP_034684.2
UniProt ID P01582

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL1a Products

Required fields are marked with *

My Review for All IL1a Products

Required fields are marked with *

0
cart-icon