Active Recombinant Mouse IL1b Protein, His-Tagged
Cat.No. : | IL1b-01M |
Product Overview : | Recombinant human IL1b protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. There are two genes for interleukin-1 (IL-1): IL-1 alpha and IL-1 beta (this gene). IL-1β precursor is cleaved by cytosolic caspase 1 (interleukin 1 beta convertase) to form mature IL-1β. |
Form : | Lyophilized powder |
AA Sequence : | MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYP KKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is <8 pg/mL. The specific activity of recombinant mouse IL-1 beta is approximately >1.2x 10^8 IU/mg. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il1b interleukin 1 beta [ Mus musculus (house mouse) ] |
Official Symbol | Il1b |
Synonyms | Il-1b; IL-1beta |
Gene ID | 16176 |
mRNA Refseq | NM_008361.4 |
Protein Refseq | NP_032387.1 |
UniProt ID | P10749 |
◆ Recombinant Proteins | ||
IL1B-1024P | Recombinant Pig IL1B protein(Ala115-Pro267) | +Inquiry |
Il1b-5314M | Recombinant Mouse Il1b protein, His-tagged | +Inquiry |
il1b-3668Z | Recombinant Zebrafish il1b protein, His-tagged | +Inquiry |
IL1b-01M | Active Recombinant Mouse IL1b Protein, His-Tagged | +Inquiry |
IL1B-1458C | Recombinant Cynomolgus IL1B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1B-853HCL | Recombinant Human IL1B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1b Products
Required fields are marked with *
My Review for All IL1b Products
Required fields are marked with *
0
Inquiry Basket