Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Description : |
Interleukin 1 beta (IL-1β) also known as leukocytic pyrogen, leukocytic endogenous mediator, mononuclear cell factor, lymphocyte activating factor and other names, is a cytokine protein that in humans is encoded by the IL1B gene. There are two genes for interleukin-1 (IL-1): IL-1 alpha and IL-1 beta (this gene). IL-1β precursor is cleaved by cytosolic caspase 1 (interleukin 1 beta convertase) to form mature IL-1β. |
Form : |
Lyophilized powder |
AA Sequence : |
MVPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYP KKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVSS with polyhistidine tag at the C-terminus |
Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : |
Measure by its ability to induce D10.G4.1 cells proliferation. The ED50 for this effect is <8 pg/mL. The specific activity of recombinant mouse IL-1 beta is approximately >1.2x 10^8 IU/mg. |
Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : |
Please use within one month after protein reconstitution. |