Active Recombinant Mouse Il2 Protein, His-Tagged
| Cat.No. : | Il2-01M |
| Product Overview : | Recombinant mouse Il2 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | Interleukin-2 (IL-2) is an interleukin, a type of cytokine signaling molecule in the immune system. It is a 15,5 - 16 kDa protein that regulates the activities of white blood cells (leukocytes, often lymphocytes) that are responsible for immunity. IL-2 is part of the body's natural response to microbial infection, and in discriminating between foreign ("non-self") and "self". IL-2 mediates its effects by binding to IL-2 receptors, which are expressed by lymphocytes. |
| Form : | Lyophilized powder |
| AA Sequence : | MAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQS KSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to induce CTLL-2 cells proliferation. The ED50 for this effect is <0.3 ng/mL. The specific activity of recombinant mouse IL-2 is approximately >3 x 10^6 IU/mg. |
| Purity : | ≥98% as determined by SDS-PAGE and HPLC. Purified by Ni-NTA chromatography. |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| Gene Name | Il2 interleukin 2 [ Mus musculus (house mouse) ] |
| Official Symbol | Il2 |
| Synonyms | Il-2 |
| Gene ID | 16183 |
| mRNA Refseq | NM_008366.3 |
| Protein Refseq | NP_032392.1 |
| UniProt ID | P04351 |
| ◆ Recombinant Proteins | ||
| IL2-0182H | Active Recombinant Human IL2 protein, Fc-tagged | +Inquiry |
| IL2-246H | Active Recombinant Human IL2 Protein | +Inquiry |
| IL2-196P | Active Recombinant Pig IL2 Protein (Ala21-Thr154), C-His tagged, Animal-free, Carrier-free | +Inquiry |
| IL2-333M | Active Recombinant Mouse IL2, MIgG2a Fc-tagged | +Inquiry |
| Il2-575R | Recombinant Rat Il2 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il2 Products
Required fields are marked with *
My Review for All Il2 Products
Required fields are marked with *



