Active Recombinant Mouse Il2 Protein, His-Tagged
Cat.No. : | Il2-01M |
Product Overview : | Recombinant mouse Il2 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-2 (IL-2) is an interleukin, a type of cytokine signaling molecule in the immune system. It is a 15,5 - 16 kDa protein that regulates the activities of white blood cells (leukocytes, often lymphocytes) that are responsible for immunity. IL-2 is part of the body's natural response to microbial infection, and in discriminating between foreign ("non-self") and "self". IL-2 mediates its effects by binding to IL-2 receptors, which are expressed by lymphocytes. |
Form : | Lyophilized powder |
AA Sequence : | MAPTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQS KSFQLEDAENFISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce CTLL-2 cells proliferation. The ED50 for this effect is <0.3 ng/mL. The specific activity of recombinant mouse IL-2 is approximately >3 x 10^6 IU/mg. |
Purity : | ≥98% as determined by SDS-PAGE and HPLC. Purified by Ni-NTA chromatography. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il2 interleukin 2 [ Mus musculus (house mouse) ] |
Official Symbol | Il2 |
Synonyms | Il-2 |
Gene ID | 16183 |
mRNA Refseq | NM_008366.3 |
Protein Refseq | NP_032392.1 |
UniProt ID | P04351 |
◆ Recombinant Proteins | ||
IL2-635C | Recombinant Cattle IL2 protein, His & T7-tagged | +Inquiry |
IL2-1027P | Recombinant Pig IL2 Protein, His-tagged | +Inquiry |
IL2-600P | Recombinant Pig IL2 protein | +Inquiry |
IL2-29H | Active Recombinant Human IL2 protein | +Inquiry |
IL2-07H | Active Recombinant Human IL2 Protein, Pre-aliquoted | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il2 Products
Required fields are marked with *
My Review for All Il2 Products
Required fields are marked with *