Active Recombinant Mouse Il30 Protein, His-Tagged

• Cat.No.: Il30-01M
• Product Overview: Recombinant mouse Il30 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: Interleukin-30 (IL-30) is a protein with a molecular weight of 28 kilodaltons, which forms one chain of the heterodimeric cytokine called interleukin 27 (IL-27), thus is sometimes called IL27-p28. The other chain of IL-27 is a molecule called Epstein-Barr induced gene-3 (EBI3). IL-30 is a member of the long-chain, 4-helix bundle family of cytokines, making it structurally similar to IL-6. This gene for this molecule is now officially called IL-27 under HGNC guidelines.
• Form: Lyophilized powder
• AA Sequence: MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGT
  QGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLS
  RAVRDLLLLSLPRRPGSAWDS with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <5 ng/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il27 interleukin 27 [ Mus musculus (house mouse) ]
• Official Symbol: Il30
• Synonyms: p28; IL-27; IL27-A; IL-27-A; IL-27p28
• Gene ID: 246779
• mRNA Refseq: NM_145636.2
• Protein Refseq: NP_663611.1
• UniProt ID: Q8K3I6