Active Recombinant Mouse Il33 Protein (158 aa)
Cat.No. : | Il33-026I |
Product Overview : | Recombinant Mouse Il33 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Protein Length : | 158 |
Description : | IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is ≤ 0.5 ng/mL, corresponding to a specific activity of ≥ 2 × 10^6units/mg. |
Molecular Mass : | Approximately 17.5 kDa protein containing 158 amino acid residues |
AA Sequence : | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
Endotoxin : | Less than 1 EU/mg of rmIL-33 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered solution in PBS, EDTA and DTT. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Il33 interleukin 33 [ Mus musculus ] |
Official Symbol | Il33 |
Synonyms | IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik; |
Gene ID | 77125 |
mRNA Refseq | NM_001164724 |
Protein Refseq | NP_001158196 |
UniProt ID | Q8BVZ5 |
◆ Recombinant Proteins | ||
IL33-760H | Recombinant Human IL33 protein, His-Avi-tagged | +Inquiry |
IL33-320H | Recombinant Human Interleukin 33 | +Inquiry |
IL33-643D | Recombinant Dog IL33 protein(102-263aa), His-tagged | +Inquiry |
IL33-164C | Recombinant Cynomolgus IL33 Protein | +Inquiry |
Il33-583R | Recombinant Rat Il33 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL33-5226HCL | Recombinant Human IL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *
0
Inquiry Basket