Active Recombinant Mouse Il33 Protein (158 aa)
| Cat.No. : | Il33-026I |
| Product Overview : | Recombinant Mouse Il33 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Protein Length : | 158 |
| Description : | IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is ≤ 0.5 ng/mL, corresponding to a specific activity of ≥ 2 × 10^6units/mg. |
| Molecular Mass : | Approximately 17.5 kDa protein containing 158 amino acid residues |
| AA Sequence : | SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI |
| Endotoxin : | Less than 1 EU/mg of rmIL-33 as determined by LAL method. |
| Purity : | >98% by SDS-PAGE and HPLC analyses. |
| Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
| Storage Buffer : | Lyophilized from a 0.2mm filtered solution in PBS, EDTA and DTT. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
| Gene Name | Il33 interleukin 33 [ Mus musculus ] |
| Official Symbol | Il33 |
| Synonyms | IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik; |
| Gene ID | 77125 |
| mRNA Refseq | NM_001164724 |
| Protein Refseq | NP_001158196 |
| UniProt ID | Q8BVZ5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il33 Products
Required fields are marked with *
My Review for All Il33 Products
Required fields are marked with *



