Active Recombinant Mouse Il33 Protein (158 aa)

Name: Active Recombinant Mouse Il33 Protein (158 aa)
SKU: Il33-026I

Species :	Mouse
Source :	E.coli
Protein Length :	158
Description :	IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor activating NF-kappaB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	The ED50 was determined by the dose-dependent stimulation of the proliferation of murine D10S cells is ≤ 0.5 ng/mL, corresponding to a specific activity of ≥ 2 × 10^6units/mg.
Molecular Mass :	Approximately 17.5 kDa protein containing 158 amino acid residues
AA Sequence :	SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Endotoxin :	Less than 1 EU/mg of rmIL-33 as determined by LAL method.
Purity :	>98% by SDS-PAGE and HPLC analyses.
Storage :	This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer :	Lyophilized from a 0.2mm filtered solution in PBS, EDTA and DTT.
Reconstitution :	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Name	Il33 interleukin 33 [ Mus musculus ]
Official Symbol	Il33
Synonyms	IL33; interleukin 33; interleukin-33; nuclear factor from high endothelial venules; Il-33; Il1f11; NF-HEV; 9230117N10Rik;
Gene ID	77125
mRNA Refseq	NM_001164724
Protein Refseq	NP_001158196
UniProt ID	Q8BVZ5