Active Recombinant Mouse Il4 Protein, His-Tagged

• Cat.No.: Il4-01M
• Product Overview: Recombinant mouse Il4 Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13.
• Form: Lyophilized powder
• AA Sequence: MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISC
  TMNESKSTSLKDFLESLKSIMQMDYS with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce HT-2 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately >1 x 10^6 IU/mg.
• Purity: ≥98% as determined by SDS-PAGE and HPLC.
  Purified by Ni-NTA chromatography.
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Il4 interleukin 4 [ Mus musculus (house mouse) ]
• Official Symbol: Il4
• Synonyms: Il-4; BSF-1
• Gene ID: 16189
• mRNA Refseq: NM_021283.2
• Protein Refseq: NP_067258.1
• UniProt ID: P07750