Active Recombinant Mouse Il4 Protein, His-Tagged
| Cat.No. : | Il4-01M |
| Product Overview : | Recombinant mouse Il4 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | The interleukin 4 (IL4, IL-4) is a cytokine that induces differentiation of naive helper T cells (Th0 cells) to Th2 cells. Upon activation by IL-4, Th2 cells subsequently produce additional IL-4 in a positive feedback loop. The cell that initially produces IL-4, thus inducing Th2 differentiation, has not been identified, but recent studies suggest that basophils may be the effector cell. It is closely related and has functions similar to Interleukin 13. |
| Form : | Lyophilized powder |
| AA Sequence : | MHIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCRASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISC TMNESKSTSLKDFLESLKSIMQMDYS with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to induce HT-2 cells proliferation. The ED50 for this effect is <1 ng/mL. The specific activity of recombinant mouse IL-4 is approximately >1 x 10^6 IU/mg. |
| Purity : | ≥98% as determined by SDS-PAGE and HPLC. Purified by Ni-NTA chromatography. |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| Gene Name | Il4 interleukin 4 [ Mus musculus (house mouse) ] |
| Official Symbol | Il4 |
| Synonyms | Il-4; BSF-1 |
| Gene ID | 16189 |
| mRNA Refseq | NM_021283.2 |
| Protein Refseq | NP_067258.1 |
| UniProt ID | P07750 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il4 Products
Required fields are marked with *
My Review for All Il4 Products
Required fields are marked with *
