Active Recombinant Mouse Kitl Protein (165 aa)
Cat.No. : | Kitl-151K |
Product Overview : | Recombinant Mouse Kitl Protein (165 aa) without tag was expressed in P. pastoris. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | P.pastoris |
Protein Length : | 165 |
Description : | Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 10.0 ng/mL, measured by a cell proliferation assay using human TF-1 cells, corresponding to a specific activity of > 1.0 × 10^5 units/mg. |
Molecular Mass : | 18.4kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant mouse Stem Cell Factor (rmSCF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmSCF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 50mM Tris, pH8.0. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Kitl kit ligand [ Mus musculus (house mouse) ] |
Official Symbol | Kitl |
Synonyms | Kitl; kit ligand; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted; kit ligand; C-kit ligand; Steel factor; cloud gray; grizzle-belly; hematopoietic growth factor KL; mast cell growth factor; stem cell factor; EC 3.2.1.31 |
Gene ID | 17311 |
mRNA Refseq | NM_013598 |
Protein Refseq | NP_038626 |
UniProt ID | P20826 |
◆ Recombinant Proteins | ||
KITL-524M | Recombinant Mouse KITL Protein, Biotinylated | +Inquiry |
Kitl-792M | Recombinant Mouse Kitl protein, His-tagged | +Inquiry |
KITLG-829M | Recombinant Mouse KITLG Protein (Met1-Ala189), His-tagged, Biotinylated | +Inquiry |
KITL-8666M | Recombinant Mouse KITL Protein | +Inquiry |
KITLG-141H | Active Recombinant Human KITLG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Kitlg Products
Required fields are marked with *
My Review for All Kitlg Products
Required fields are marked with *