Active Recombinant Mouse Kitl Protein (165 aa)

Cat.No. : Kitl-151K
Product Overview : Recombinant Mouse Kitl Protein (165 aa) without tag was expressed in P. pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : P.pastoris
Protein Length : 165
Description : Stem Cell Factor (SCF) is a hematopoietic growth factor that binds to the c-Kit receptor. SCF exerts its activity during the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 10.0 ng/mL, measured by a cell proliferation assay using human TF-1 cells, corresponding to a specific activity of > 1.0 × 10^5 units/mg.
Molecular Mass : 18.4kDa, observed by reducing SDS-PAGE.
AA Sequence : MKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant mouse Stem Cell Factor (rmSCF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmSCF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50mM Tris, pH8.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Kitl kit ligand [ Mus musculus (house mouse) ]
Official Symbol Kitl
Synonyms Kitl; kit ligand; Gb; SF; Sl; Clo; Con; Mgf; SCF; SLF; blz; Kitlg; contrasted; kit ligand; C-kit ligand; Steel factor; cloud gray; grizzle-belly; hematopoietic growth factor KL; mast cell growth factor; stem cell factor; EC 3.2.1.31
Gene ID 17311
mRNA Refseq NM_013598
Protein Refseq NP_038626
UniProt ID P20826

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Kitlg Products

Required fields are marked with *

My Review for All Kitlg Products

Required fields are marked with *

0
cart-icon
0
compare icon