Active Recombinant Mouse Lif Protein

Cat.No. : Lif-7267M
Product Overview : Recombinant Mouse LIF is a 19.9 kDa protein containing 180 amino acids residues, including three disulfide bonds without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Form : Lyophilized (0.2 μm Sterile filtered) purified protein with no Additives
Bio-activity : Murine LIF is fully biologically active when compared to standards. The ED50 as determined by the M1 cell differentiation assay is = 0.05 ng/mL, corresponding to a specific activity of = 2 × 10^7 units/mg.
Molecular Mass : 19.9 kDa
AA Sequence : SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF
Endotoxin : < 0.1 ng/μg (1EU/μg)
Purity : > 98 % by SDS-PAGE and HPLC
Stability : Shelf life: one year from despatch.
Storage : Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term.
After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term.
Avoid repeated freezing and thawing.
Reconstitution : Restore in sterile water to a concentration of 0.1-1.0 mg/mL. Centrifuge the vial bevor opening. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1 % BSA) and store in working aliquots at -20 to -80 centigrade.
Gene Name Lif leukemia inhibitory factor [ Mus musculus (house mouse) ]
Official Symbol Lif
Synonyms Lif; leukemia inhibitory factor; leukemia inhibitory factor; d factor; differentiation-stimulating factor; myeloid leukaemia inhibitory factor
Gene ID 16878
mRNA Refseq NM_001039537
Protein Refseq NP_001034626
UniProt ID P09056

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lif Products

Required fields are marked with *

My Review for All Lif Products

Required fields are marked with *

0

Inquiry Basket

cartIcon