Active Recombinant Mouse Lif Protein
Cat.No. : | Lif-7267M |
Product Overview : | Recombinant Mouse LIF is a 19.9 kDa protein containing 180 amino acids residues, including three disulfide bonds without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes. |
Form : | Lyophilized (0.2 μm Sterile filtered) purified protein with no Additives |
Bio-activity : | Murine LIF is fully biologically active when compared to standards. The ED50 as determined by the M1 cell differentiation assay is = 0.05 ng/mL, corresponding to a specific activity of = 2 × 10^7 units/mg. |
Molecular Mass : | 19.9 kDa |
AA Sequence : | SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF |
Endotoxin : | < 0.1 ng/μg (1EU/μg) |
Purity : | > 98 % by SDS-PAGE and HPLC |
Stability : | Shelf life: one year from despatch. |
Storage : | Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term. After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term. Avoid repeated freezing and thawing. |
Reconstitution : | Restore in sterile water to a concentration of 0.1-1.0 mg/mL. Centrifuge the vial bevor opening. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1 % BSA) and store in working aliquots at -20 to -80 centigrade. |
Gene Name | Lif leukemia inhibitory factor [ Mus musculus (house mouse) ] |
Official Symbol | Lif |
Synonyms | Lif; leukemia inhibitory factor; leukemia inhibitory factor; d factor; differentiation-stimulating factor; myeloid leukaemia inhibitory factor |
Gene ID | 16878 |
mRNA Refseq | NM_001039537 |
Protein Refseq | NP_001034626 |
UniProt ID | P09056 |
◆ Recombinant Proteins | ||
Lif-65M | Active Recombinant Mouse Lif Protein (Ser24-Phe203), N-His tagged, Animal-free, Carrier-free | +Inquiry |
LIF-635H | Active Recombinant Human LIF, Fc-tagged, Biotinylated | +Inquiry |
Lif-1317M | Recombinant Mouse Lif Protein, MYC/DDK-tagged | +Inquiry |
LIF-301508H | Recombinant Human LIF protein, GST-tagged | +Inquiry |
Lif-122M | Recombinant Mouse Lif Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Lif Products
Required fields are marked with *
My Review for All Lif Products
Required fields are marked with *