Active Recombinant Mouse LIGHT Protein, His-Tagged

Cat.No. : LIGHT-01M
Product Overview : Recombinant mouse LIGHT Protein, His-tagged was expressed in E. coli cell
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : LIGHT is a member of the TNF family of ligands, and can conduct signaling through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LTβR, or binding to a decoy receptor, DcR3. LIGHT generally expresses in splenocytes, activated PBL, CD8+ tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT can also activate NF-κB, to co-stimulate the activation of lymphocytes and induce apoptosis in certain human tumor cells.
Form : Lyophilized powder
AA Sequence : MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQL
SGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFM
V with polyhistidine tag at the C-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Bio-activity : Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect is <2 μg/mL.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Notes : Please use within one month after protein reconstitution.
Gene Name Tnfsf14 tumor necrosis factor (ligand) superfamily, member 14 [ Mus musculus (house mouse) ]
Official Symbol LIGHT
Synonyms LTg; HVEML; Tnfsf14; Ly113; HVEM-L; Tnlg1d
Gene ID 50930
mRNA Refseq NM_019418.3
Protein Refseq NP_062291.1
UniProt ID Q059Y9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIGHT Products

Required fields are marked with *

My Review for All LIGHT Products

Required fields are marked with *

0
cart-icon