Active Recombinant Mouse LIGHT Protein, His-Tagged

• Cat.No.: LIGHT-01M
• Product Overview: Recombinant mouse LIGHT Protein, His-tagged was expressed in E. coli cell

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Description: LIGHT is a member of the TNF family of ligands, and can conduct signaling through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LTβR, or binding to a decoy receptor, DcR3. LIGHT generally expresses in splenocytes, activated PBL, CD8+ tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT can also activate NF-κB, to co-stimulate the activation of lymphocytes and induce apoptosis in certain human tumor cells.
• Form: Lyophilized powder
• AA Sequence: MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQL
  SGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFM
  V with polyhistidine tag at the C-terminus
• Endotoxin: <0.1 EU per 1 μg of the protein by the LAL method.
• Bio-activity: Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect is <2 μg/mL.
• Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography
• Storage Buffer: The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
• Reconstitution: It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
• Storage: Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
• Notes: Please use within one month after protein reconstitution.

Gene Information

• Gene Name: Tnfsf14 tumor necrosis factor (ligand) superfamily, member 14 [ Mus musculus (house mouse) ]
• Official Symbol: LIGHT
• Synonyms: LTg; HVEML; Tnfsf14; Ly113; HVEM-L; Tnlg1d
• Gene ID: 50930
• mRNA Refseq: NM_019418.3
• Protein Refseq: NP_062291.1
• UniProt ID: Q059Y9