Active Recombinant Mouse LIGHT Protein, His-Tagged
Cat.No. : | LIGHT-01M |
Product Overview : | Recombinant mouse LIGHT Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | LIGHT is a member of the TNF family of ligands, and can conduct signaling through the herpes virus entry mediator type A receptor (HVEM, TNFRSF14), LTβR, or binding to a decoy receptor, DcR3. LIGHT generally expresses in splenocytes, activated PBL, CD8+ tumor infiltrating lymphocytes, granulocytes, and monocytes. LIGHT can also activate NF-κB, to co-stimulate the activation of lymphocytes and induce apoptosis in certain human tumor cells. |
Form : | Lyophilized powder |
AA Sequence : | MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQL SGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFM V with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect is <2 μg/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Tnfsf14 tumor necrosis factor (ligand) superfamily, member 14 [ Mus musculus (house mouse) ] |
Official Symbol | LIGHT |
Synonyms | LTg; HVEML; Tnfsf14; Ly113; HVEM-L; Tnlg1d |
Gene ID | 50930 |
mRNA Refseq | NM_019418.3 |
Protein Refseq | NP_062291.1 |
UniProt ID | Q059Y9 |
◆ Recombinant Proteins | ||
LIGHT-2390H | Recombinant Human LIGHT protein(Asp74-Val240), Avi&Fc-tagged, Biotinylated | +Inquiry |
LIGHT-01M | Active Recombinant Mouse LIGHT Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIGHT Products
Required fields are marked with *
My Review for All LIGHT Products
Required fields are marked with *
0
Inquiry Basket