Active Recombinant Mouse Mmp9 Protein (20-730aa), C-His-tagged

• Cat.No.: Mmp9-03M
• Product Overview: Recombinant mouse MMP-9 protein (20-730aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 20-730aa
• Description: This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme that degrades collagens of type IV, V and XI, and elastin. Mice lacking the encoded protein exhibit an abnormal pattern of skeletal growth plate vascularization and ossification, reduced keratinocyte hyperproliferation at all neoplastic stages, a decreased incidence of invasive tumors, and resistance to experimental autoimmune encephalomyelitis.
• Form: Liquid
• Bio-activity: > 1,500 pmol/min/μg, and is defined as the amount of enzyme that cleaves 1 pmol of Mca-PLGL-Dpa-AR-NH2 per minute at pH 7.5 at 25 centigrade.
• Molecular Mass: 79.3 kDa (717aa)
• AA Sequence: APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE, Enzyme Activity
• Notes: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 1 mg/mL (determined by Bradford assay)
• Storage Buffer: Liquid in. 20mM Tris-HCl (pH 7.5) containing 1mM CaCl2, 100mM NaCl, 10% glycerol

Gene Information

• Gene Name: Mmp9 matrix metallopeptidase 9 [ Mus musculus (house mouse) ]
• Official Symbol: Mmp9
• Synonyms: MMP9; matrix metallopeptidase 9; matrix metalloproteinase-9; GELB; Gel B; gelatinase B; 92kD gelatinase; 92kDa gelatinase; 92 kDa gelatinase; collagenase type IVB; 92kD type IV collagenase; 92kDa type IV collagenase; 92 kDa type IV collagenase; matrix metalloproteinase 9; Clg4b; MMP-9; B/MMP9; AW743869; pro-MMP-9
• Gene ID: 17395
• mRNA Refseq: NM_013599
• Protein Refseq: NP_038627
• UniProt ID: P41245