Active Recombinant Mouse Mmp9 Protein (20-730aa), C-His-tagged

Cat.No. : Mmp9-03M
Product Overview : Recombinant mouse MMP-9 protein (20-730aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 20-730aa
Description : This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme that degrades collagens of type IV, V and XI, and elastin. Mice lacking the encoded protein exhibit an abnormal pattern of skeletal growth plate vascularization and ossification, reduced keratinocyte hyperproliferation at all neoplastic stages, a decreased incidence of invasive tumors, and resistance to experimental autoimmune encephalomyelitis.
Form : Liquid
Bio-activity : > 1,500 pmol/min/μg, and is defined as the amount of enzyme that cleaves 1 pmol of Mca-PLGL-Dpa-AR-NH2 per minute at pH 7.5 at 25 centigrade.
Molecular Mass : 79.3 kDa (717aa)
AA Sequence : APYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Enzyme Activity
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : Liquid in. 20mM Tris-HCl (pH 7.5) containing 1mM CaCl2, 100mM NaCl, 10% glycerol
Gene Name Mmp9 matrix metallopeptidase 9 [ Mus musculus (house mouse) ]
Official Symbol Mmp9
Synonyms MMP9; matrix metallopeptidase 9; matrix metalloproteinase-9; GELB; Gel B; gelatinase B; 92kD gelatinase; 92kDa gelatinase; 92 kDa gelatinase; collagenase type IVB; 92kD type IV collagenase; 92kDa type IV collagenase; 92 kDa type IV collagenase; matrix metalloproteinase 9; Clg4b; MMP-9; B/MMP9; AW743869; pro-MMP-9;
Gene ID 17395
mRNA Refseq NM_013599
Protein Refseq NP_038627
UniProt ID P41245

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mmp9 Products

Required fields are marked with *

My Review for All Mmp9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon